DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi14 and Osi12

DIOPT Version :9

Sequence 1:NP_649635.1 Gene:Osi14 / 40770 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_649631.1 Gene:Osi12 / 40766 FlyBaseID:FBgn0037419 Length:295 Species:Drosophila melanogaster


Alignment Length:285 Identity:83/285 - (29%)
Similarity:139/285 - (48%) Gaps:45/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFAIACVTLLAASCVFAA------PSVQDNQVEGDNTLGRAARYLGACLESD-DMATCLAVKGIT 60
            :.::..|..||:||..|.      |....:|..|..||   .|....|..:: ....||..|.|:
  Fly    11 LISLLSVLFLASSCGAATEQLGSPPGPSPSQSAGARTL---LRVYDECTRAEAGFVPCLKKKAIS 72

  Fly    61 ALNRAARSNNIELASGV------TFQRDPASPVSRTGKSMSEQDVYAELPQNADERTGRLVDLAV 119
            .::|.|..:.|.:|.|:      |..|.||:         ||.::.:.||::..:|..:|.::.:
  Fly    73 FIDRLAPIDAINVAEGIKLVRLETAPRPPAT---------SENELESSLPRSGSDRDAKLTNMLI 128

  Fly   120 SSAADFLSTHNLEFKLPAETTQQVARALDEGRGKIKKMLGPVALAIGAKLFAVIPLVLGFLALLT 184
            ...:.|.:.|:|:...|..|:.::.|.|:|||||:|||:|.:.:.:..|:..:||:.:|.|.:|.
  Fly   129 ERLSYFFNGHSLQVSFPKLTSDEIGRGLEEGRGKMKKMMGMMMMGMAMKMMGMIPIAMGALYILA 193

  Fly   185 FKAVIVAKLAFFLAILVGGSRLLGGFGNKFGGNSFAGAYNSNAWSA---PASAGWSSGASSSYPY 246
            .||:|::|:|..||.::|..:|:.  |...||        |:.||:   ....|||||.......
  Fly   194 GKALIISKIALLLAGIIGLKKLMS--GKSSGG--------SSGWSSGGGGGGGGWSSGGGGGGGG 248

  Fly   247 A---RSISEDGSDAQQLAYAGQQQQ 268
            .   ||::|    ||:|||....|:
  Fly   249 GWDRRSLTE----AQELAYRAHHQE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 30/103 (29%)
Osi12NP_649631.1 DUF1676 74..159 CDD:285181 22/93 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AK5C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.