DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi14 and Osi8

DIOPT Version :9

Sequence 1:NP_649635.1 Gene:Osi14 / 40770 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_649627.1 Gene:Osi8 / 40762 FlyBaseID:FBgn0037415 Length:274 Species:Drosophila melanogaster


Alignment Length:253 Identity:78/253 - (30%)
Similarity:117/253 - (46%) Gaps:41/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PSVQDNQVEGDNT-----LGRAARYLGACLESDDMATCLAVKGITALNRAARS-NNIELASGVTF 79
            |.||::.....:|     :....|....| ..|:|:.||.||.:|.|.:|.|| .::.|..|:.|
  Fly    40 PQVQNSNPGMGSTGLWKDMSMVYRIYQQC-SGDNMSVCLKVKLLTGLEKAFRSAKSLSLMEGIQF 103

  Fly    80 QRDPASPVSRTGKS-------MSEQDVYAELPQNADERTGRLVDLAVSSAADFLSTHNLEFKLPA 137
                   ||..|:|       :||:|:.|.||::.|.:...|.::.:....:||..|.|:.|...
  Fly   104 -------VSSGGESEETKRAPISEKDIEAVLPRSVDAKEQVLNNMILKRVGNFLQDHTLQVKFDN 161

  Fly   138 ETTQQVARALDEGRGKIKKMLGPVALAIGAKLFAVIPLVLGFLALLTFKAVIVAKLAFFLAILVG 202
            |......|...|.:|....::.|  |.:|.   .::||..|.||:|..||:||:|||..||.::|
  Fly   162 EANSVEGRKKKEKKGNGAMIMIP--LLLGG---TIVPLAYGALAMLAGKALIVSKLALVLASIIG 221

  Fly   203 GSRLL-GGFGNK---------FGGNSFAGAYNSNAWSAPASAGWSSGASSSYPYARSI 250
            ..:|| ||.|.|         .||:|..|.....|:|     ||...|..|...|:|:
  Fly   222 IKKLLSGGGGGKESSHEVVVSSGGHSGWGRELDTAYS-----GWKPAAKESAGSAKSL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 28/105 (27%)
Osi8NP_649627.1 DUF1676 85..>169 CDD:285181 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AK5C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.