DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi14 and Osi5

DIOPT Version :9

Sequence 1:NP_649635.1 Gene:Osi14 / 40770 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_649624.1 Gene:Osi5 / 40759 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster


Alignment Length:281 Identity:66/281 - (23%)
Similarity:98/281 - (34%) Gaps:101/281 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KVFAIACVTLLAASCVFAAPSVQDNQVEGDNTLGRAARYLGACLESDDMATCLAVKGITALNRAA 66
            :.|.:.|:..|.|             |..:|           |  ..|....|..:|..||....
  Fly     3 RTFPLLCLLFLTA-------------VRSEN-----------C--DQDAGATLYCRGERALRNVL 41

  Fly    67 RSNN-----IELASGVTFQRDPASPVSRTGKSMSEQDVYAELPQNADERTGRLVDLAVSSAADFL 126
            |:.|     :.:..|:..       |.....|:|:::        .|:..|.|     .|.:.:|
  Fly    42 RNLNRSDKPLVVIRGLEI-------VPLQNNSISDEE--------PDQEQGLL-----DSLSFYL 86

  Fly   127 STHNLEFKLP--AETTQQV--ARALDEGRGKIKKMLGPVALAIGAKLFAVIPLVLGFLALLTFKA 187
            .||.:..||.  .|...||  ||..|:|:|    ||..:||..| |:.||  :.||.:|.|..||
  Fly    87 RTHEINVKLADLLEDESQVSEARKKDKGQG----MLLAMALMFG-KMMAV--MGLGGIAALAMKA 144

  Fly   188 VIVAKLAFFLAILVGGSRLLGGFGNKFGGNSFAGAYNSNAWSAPASAGWSSGASSSYPYARSISE 252
            :.|:.:|..:|.::|                         ....|..|..|..|.||     ::.
  Fly   145 LGVSLVALMMAGMLG-------------------------LKTAAQHGGESSHSISY-----VTG 179

  Fly   253 DG---------SDAQQLAYAG 264
            :|         |..|.|||.|
  Fly   180 EGHHHKRRRRSSGQQPLAYRG 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 26/106 (25%)
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 23/89 (26%)
RCR 184..>201 CDD:304939 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.