DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi14 and Osi2

DIOPT Version :9

Sequence 1:NP_649635.1 Gene:Osi14 / 40770 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001262303.1 Gene:Osi2 / 40756 FlyBaseID:FBgn0037410 Length:390 Species:Drosophila melanogaster


Alignment Length:273 Identity:67/273 - (24%)
Similarity:107/273 - (39%) Gaps:49/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ARYLGACLESDDMATCLAVKGITALNRAARSNNIELASGVTFQRDPASPVSRTGKSMSEQDVYAE 102
            ||....|| ..|::.|...:.:...:.....:..:|:.   |.|....|.::....:.|...|:|
  Fly    85 ARTNSNCL-GGDLSECFKTQALNTFDEIFFKDQYKLSD---FARVVRLPETQQRSLLQEPFEYSE 145

  Fly   103 LPQNADERTGRLVDLAVSSAADFLSTHNLEFKLPAETTQ---QVAR-----------ALDEG--- 150
            .|:..|:...:|:...:..|..|:.:..||.:.|.|.|:   ..||           .:|:|   
  Fly   146 EPRGDDDEWNQLLKYGLRRAERFIKSTALEVEWPEELTEAGRYEARFIGNDIDGELDLIDDGQRA 210

  Fly   151 ----RGKIKKMLGPVALAI---GAKLFAVIPLVLGFLAL---LTFKAVIVAKLAFFLAIL----- 200
                |.|:|||:.|:.|.:   ..||...:|.:||...|   |...|:::..|..:..:.     
  Fly   211 GHFSRKKLKKMIIPLLLVLKIFKLKLLLFLPFILGIAGLKKILGLAAIVLPGLFAYFKLCRPPGG 275

  Fly   201 VGGSRLLGGFGNKFGGNSFAGAYNSNAWSAPA-------SAGWSSGASSSYPYAR---SISEDGS 255
            |||: ..||....|||.:....||.....|..       ..|...||..  ||.|   |.::..:
  Fly   276 VGGA-FGGGLSGLFGGKNTFPEYNPQGVGAATYYHHHEHFEGGHGGAPG--PYYRQEPSFAKPYT 337

  Fly   256 DAQQLAYAGQQQQ 268
            |....:|.|||.|
  Fly   338 DYYSKSYQGQQVQ 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 26/118 (22%)
Osi2NP_001262303.1 DUF1676 108..224 CDD:285181 26/118 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.