DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi14 and Osi16

DIOPT Version :9

Sequence 1:NP_649635.1 Gene:Osi14 / 40770 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_731065.1 Gene:Osi16 / 318801 FlyBaseID:FBgn0051561 Length:278 Species:Drosophila melanogaster


Alignment Length:281 Identity:73/281 - (25%)
Similarity:118/281 - (41%) Gaps:53/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VTLLAASCVFA-APSVQDNQV-----EGDNTLGRAARYLGACLESDDMATCLAVKGITALNRAAR 67
            :.|.|..|.:| |.|||..:|     |......||...|..|..|.....||.::.:..:.:.|.
  Fly    13 LALFAFMCKYATAASVQPTEVPAVAPETIRIPQRAESLLSGCEASSFSWMCLKIEFVKIMEKLAE 77

  Fly    68 SNNIELASGVTFQRDPASPVSRTGKSMSEQDVYAELPQNADERTGRLVDLAVSSAADFLSTHNLE 132
            ...:.:..|::..:|..:...:|.:.|:|  |....|  :|..| ||....|:...:.|.|..|.
  Fly    78 QEELNVLPGISVVKDENATELKTSELMAE--VARSYP--SDPST-RLNGYIVAKLENLLRTRFLR 137

  Fly   133 FKLPAETTQQVARALDEGR-GKIKKMLGPVAL-AIGAKLFAVI-PLVLGFLALLTFKAVIVAKLA 194
            |:|..:      ::|.||| .|..|..|..|| |.|..:..:: .:.||.:||:..||::.|.:|
  Fly   138 FRLLDD------KSLVEGRKHKFGKKGGLEALVAAGVMMKGMLMAMGLGAIALMAGKALMTALMA 196

  Fly   195 FFLAILVGGSRLLGGFG----------------------NKFGGNSFAGAYNSNAWSAPASAGWS 237
            ..|:.::|...|.||.|                      ::.||:|.:..:        |:.|..
  Fly   197 LTLSGVLGLKSLAGGGGKSTTYEIVAKPIYTSSHSHSVTHEDGGHSHSPHF--------AAGGGG 253

  Fly   238 SGASSSY---PYARSISEDGS 255
            .|.:|.:   .||||:..|.|
  Fly   254 GGTASGFGYGGYARSLKVDQS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 24/98 (24%)
Osi16NP_731065.1 DUF1676 72..156 CDD:285181 23/94 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.