Sequence 1: | NP_649634.1 | Gene: | Osi13 / 40769 | FlyBaseID: | FBgn0037422 | Length: | 210 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262307.1 | Gene: | Osi17 / 40774 | FlyBaseID: | FBgn0037427 | Length: | 750 | Species: | Drosophila melanogaster |
Alignment Length: | 240 | Identity: | 48/240 - (20%) |
---|---|---|---|
Similarity: | 75/240 - (31%) | Gaps: | 107/240 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MFKSSISIVVLHLLLL----VSFGGA-YTLPPVVQMGGAIVAAVEQDAEQEAAAEERQRVERHWL 60
Fly 61 SMAETQLHSLITDDLSTEEVNNMLETWSTEGRGKHKKQKKLM--KMVYPLLAAVAVAKVVLLPLI 123
Fly 124 LKWLTALSTSSFVMGKIALVTSGILALKWIL---------------------------------- 154
Fly 155 ----------SGGHAHDRLEIIHSHAPLVKG-----LHASDLSSS 184 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Osi13 | NP_649634.1 | None | |||
Osi17 | NP_001262307.1 | DUF1676 | 180..270 | CDD:285181 | 10/37 (27%) |
Prefoldin | 603..>680 | CDD:298833 | |||
DM4_12 | 661..745 | CDD:299813 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR21879 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |