DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi13 and Osi17

DIOPT Version :9

Sequence 1:NP_649634.1 Gene:Osi13 / 40769 FlyBaseID:FBgn0037422 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001262307.1 Gene:Osi17 / 40774 FlyBaseID:FBgn0037427 Length:750 Species:Drosophila melanogaster


Alignment Length:240 Identity:48/240 - (20%)
Similarity:75/240 - (31%) Gaps:107/240 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKSSISIVVLHLLLL----VSFGGA-YTLPPVVQMGGAIVAAVEQDAEQEAAAEERQRVERHWL 60
            ::..||...:.|.|.:    |.|.|| :.:.|....|..|:|.:|...:|...|.         |
  Fly   232 LYGKSIKFAMTHDLEVDLPEVMFNGATFRISPRAIEGNGIIAKLELIPKQVVKAR---------L 287

  Fly    61 SMAETQLHSLITDDLSTEEVNNMLETWSTEGRGKHKKQKKLM--KMVYPLLAAVAVAKVVLLPLI 123
            :.|..|                             ||.:|.:  |:|...||.:.:.|::.:.|.
  Fly   288 AGAIIQ-----------------------------KKIQKFLRSKLVLSFLALLLIIKIIKIKLF 323

  Fly   124 LKWLTALSTSSFVMGKIALVTSGILALKWIL---------------------------------- 154
              ||..:        .|.:..:..|.||::|                                  
  Fly   324 --WLLPI--------VIGVGAAKKLLLKFLLFLFPALSHLFKLCSHYQQSYHAPAKYHHHHHLID 378

  Fly   155 ----------SGGHAHDRLEIIHSHAPLVKG-----LHASDLSSS 184
                      ||.| |...|||::|.|  ||     ||.:.:..|
  Fly   379 HHHTVVPPWHSGEH-HSVPEIIYTHPP--KGHPSAYLHGAPVHES 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi13NP_649634.1 None
Osi17NP_001262307.1 DUF1676 180..270 CDD:285181 10/37 (27%)
Prefoldin 603..>680 CDD:298833
DM4_12 661..745 CDD:299813
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.