DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi13 and Osi8

DIOPT Version :9

Sequence 1:NP_649634.1 Gene:Osi13 / 40769 FlyBaseID:FBgn0037422 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_649627.1 Gene:Osi8 / 40762 FlyBaseID:FBgn0037415 Length:274 Species:Drosophila melanogaster


Alignment Length:214 Identity:48/214 - (22%)
Similarity:86/214 - (40%) Gaps:65/214 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FKSSISIVVLHLLLLVSFGGAYTLPPVVQMGGAIVAAVEQDAEQEAAAEERQRVERHWLSMAETQ 66
            |:|:.|:.::..:..||.||                          .:||.:|.     .::|..
  Fly    89 FRSAKSLSLMEGIQFVSSGG--------------------------ESEETKRA-----PISEKD 122

  Fly    67 LHSLITDDLSTEE--VNNML-------------------ETWSTEGRGKHKKQKKLMKMVYPLLA 110
            :.:::...:..:|  :|||:                   |..|.|||.|.:|:.....::.|||.
  Fly   123 IEAVLPRSVDAKEQVLNNMILKRVGNFLQDHTLQVKFDNEANSVEGRKKKEKKGNGAMIMIPLLL 187

  Fly   111 AVAVAKVVLLPLILKWLTALSTSSFVMGKIALVTSGILALKWILSGGHAHDRLEIIHSHAPLV-K 174
            ...:     :||....|..|:..:.::.|:|||.:.|:.:|.:||||.....    .||..:| .
  Fly   188 GGTI-----VPLAYGALAMLAGKALIVSKLALVLASIIGIKKLLSGGGGGKE----SSHEVVVSS 243

  Fly   175 GLHAS---DLSSSGSSWMP 190
            |.|:.   :|.::.|.|.|
  Fly   244 GGHSGWGRELDTAYSGWKP 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi13NP_649634.1 None
Osi8NP_649627.1 DUF1676 85..>169 CDD:285181 18/110 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453109
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.