DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi13 and Osi7

DIOPT Version :9

Sequence 1:NP_649634.1 Gene:Osi13 / 40769 FlyBaseID:FBgn0037422 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_649626.1 Gene:Osi7 / 40761 FlyBaseID:FBgn0037414 Length:288 Species:Drosophila melanogaster


Alignment Length:181 Identity:55/181 - (30%)
Similarity:83/181 - (45%) Gaps:43/181 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LHLLLLVSFGGAYTLPPVVQMGGA-IVAAVEQDAEQEAAAEERQRVERHWLSMAETQLHSLI-TD 73
            |.|..:.||..::|:.  |::.|| ||.||.........|.|                 ||. ::
  Fly   106 LALNRISSFLNSHTIK--VELKGADIVQAVSSTGRALEDASE-----------------SLFGSN 151

  Fly    74 DLSTEEVNNMLETWSTEGRGKHKKQKKLMKMVYPLLAAVAVAKVVLLPLILKWLTALSTSSFVMG 138
            |.:..|          |.|||.||..|::.   |:||.||:....||||:|..:..::..:.::|
  Fly   152 DPNAPE----------ESRGKKKKAAKILG---PILALVALKAAALLPLLLGAIALIAGKALLIG 203

  Fly   139 KIALVTSGILALKWILSGGHAHDRLEII-HSHAPLVKGLHASDLSSSGSSW 188
            |||||.|.::.||.:|| ...|...|:: |.|       |:|..|:|..|:
  Fly   204 KIALVLSAVIGLKKLLS-QEKHVTYEVVAHPH-------HSSSHSTSHDSY 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi13NP_649634.1 None
Osi7NP_649626.1 DUF1676 46..217 CDD:400313 43/142 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.