DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi13 and Osi6

DIOPT Version :9

Sequence 1:NP_649634.1 Gene:Osi13 / 40769 FlyBaseID:FBgn0037422 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001287192.1 Gene:Osi6 / 40760 FlyBaseID:FBgn0027527 Length:312 Species:Drosophila melanogaster


Alignment Length:179 Identity:41/179 - (22%)
Similarity:64/179 - (35%) Gaps:45/179 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SISIVVLHLLLLVSFGGAYTLPPVVQMGG-AIVAAVE----QDAEQEAAAEERQRVERHWLSM-- 62
            |.||..|.|.|.......:..|.:...|| ::|.:.|    :..:...|.|....||.....|  
  Fly    64 SDSISCLQLTLFRKAKSVFDNPQIELFGGVSLVKSNEGRQGKSLDNSLAVEAAPTVEARTAEMGN 128

  Fly    63 ----------AETQLH-----------SLITDDLSTEEVNNMLETWSTEGRGKHKKQKKLMKMVY 106
                      ||..|:           ..|.||:..:     |.....|.|   .::|||:|...
  Fly   129 YFMDNAKSFFAERSLNFNFANAARSVARAIPDDIKAD-----LRELVVESR---TRKKKLLKKFL 185

  Fly   107 PLLAAVAVAKVVLLPL--------ILKWLTALSTSSFVMGKIALVTSGI 147
            |:|..|. ||:.:|.:        :.|....:|..:|.:...|..:||:
  Fly   186 PILLGVG-AKIAVLGVGSIFGLLFLAKKALVVSVIAFFLALAAGASSGL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi13NP_649634.1 None
Osi6NP_001287192.1 DUF1676 81..176 CDD:285181 19/102 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.