DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi13 and Osi4

DIOPT Version :9

Sequence 1:NP_649634.1 Gene:Osi13 / 40769 FlyBaseID:FBgn0037422 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001262305.1 Gene:Osi4 / 40758 FlyBaseID:FBgn0037412 Length:395 Species:Drosophila melanogaster


Alignment Length:197 Identity:42/197 - (21%)
Similarity:61/197 - (30%) Gaps:106/197 - (53%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GRGKHKKQ-KKLMKMVYPL-LAA------VAVAKVVLLPLILKWLTALSTSSFVMGKIALVTSGI 147
            ||.:|:.| ||..:|..|: |||      :..||.|.|         |:..:.::.|||.|.:.|
  Fly   201 GRRRHQHQDKKQFQMFIPMYLAATTFGWTMVAAKAVGL---------LTLKALILSKIAFVVAAI 256

  Fly   148 LALKWILSG---------------------------------------------------GH-AH 160
            :.:|.::..                                                   || .|
  Fly   257 VLIKKLMDNASEKMMYQFPEQTPYMMPYGMDYPLHGAEISPEMYPSSLHHLAMAGGGQLPGHPGH 321

  Fly   161 DRLEII--HSHAPLVKGLHASDLSSSGS-----------------------SWM------PIRQP 194
            ..||.:  .||      ||::.:||.||                       |||      |.|:|
  Fly   322 PGLESLSAESH------LHSAQVSSDGSNNTQVLAALGGLGGLGHKIKREDSWMAKSKSTPARRP 380

  Fly   195 FI 196
            .|
  Fly   381 LI 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi13NP_649634.1 None
Osi4NP_001262305.1 DUF1676 <210..261 CDD:311725 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.