powered by:
Protein Alignment Osi13 and Osi3
DIOPT Version :9
Sequence 1: | NP_649634.1 |
Gene: | Osi13 / 40769 |
FlyBaseID: | FBgn0037422 |
Length: | 210 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001262304.1 |
Gene: | Osi3 / 40757 |
FlyBaseID: | FBgn0037411 |
Length: | 288 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 25/66 - (37%) |
Similarity: | 39/66 - (59%) |
Gaps: | 7/66 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 EGRGKHKKQKKLMKMVYPLLAAVAVAKVVLLPLILKWLTALSTSSFVMGKIALVTSGILALKWIL 154
||||| ||.:.|||..:|....::..|:||.|..|:..:.::.||||:.:.|::||.:|
Fly 166 EGRGK-------MKNMGPLLMMMAAKTGMVGALLLKGLFLLAGKALIVSKIALLLAVIISLKKLL 223
Fly 155 S 155
|
Fly 224 S 224
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Osi13 | NP_649634.1 |
None |
Osi3 | NP_001262304.1 |
DUF1676 |
68..180 |
CDD:285181 |
10/20 (50%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR21879 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.