DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi13 and Osi21

DIOPT Version :9

Sequence 1:NP_649634.1 Gene:Osi13 / 40769 FlyBaseID:FBgn0037422 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_609501.1 Gene:Osi21 / 34566 FlyBaseID:FBgn0283678 Length:282 Species:Drosophila melanogaster


Alignment Length:168 Identity:44/168 - (26%)
Similarity:75/168 - (44%) Gaps:45/168 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AIVAAVEQDAEQ--EAAAEERQR----------------------VERHWLSMAE--TQLHSLIT 72
            |:..|::||:.:  :..|.|:|.                      ::|..||.|:  .:.|:|..
  Fly    78 ALSRALDQDSIKIVDGLALEKQNQSETESILGSLTDARQFGNLSPIDRALLSKADKLMRTHTLKI 142

  Fly    73 D-DLSTEEVNNMLETWSTEGR------GKHKKQKKLMKMVYPLLAAVAVAKVVLLPLILKWLTAL 130
            | |:...|        .:.||      .|||:...:..:|..||.|:.:|.    ||.||.|.|:
  Fly   143 DMDVGGGE--------DSVGREHGHKKKKHKEGGHIKYVVAALLTAMGIAG----PLGLKALAAI 195

  Fly   131 STSSFVMGKIALVTSGILALKWILSGGHAHDRLEIIHS 168
            :..:.|:.|:||..:||:|||.:.|..|:.:....:|:
  Fly   196 AGKALVISKVALTIAGIIALKKLFSHDHSEETSFQVHA 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi13NP_649634.1 None
Osi21NP_609501.1 DUF1676 79..>152 CDD:285181 15/80 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.