DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi13 and Osi16

DIOPT Version :9

Sequence 1:NP_649634.1 Gene:Osi13 / 40769 FlyBaseID:FBgn0037422 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_731065.1 Gene:Osi16 / 318801 FlyBaseID:FBgn0051561 Length:278 Species:Drosophila melanogaster


Alignment Length:177 Identity:42/177 - (23%)
Similarity:67/177 - (37%) Gaps:54/177 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLVSFGGAYTLPPVVQMGGAIVAAVEQDAEQEAAAEERQRVERHWLSMAETQ-LHSLITDDLSTE 78
            |:.....:|...|..::.|.|||.:|                    ::..|: |...:.||.|. 
  Fly   103 LMAEVARSYPSDPSTRLNGYIVAKLE--------------------NLLRTRFLRFRLLDDKSL- 146

  Fly    79 EVNNMLETWSTEGRGKHKKQKKLMKMVYPLLAAVAVAKVVLLPLILKWLTALSTSSFVMGKIALV 143
                      .||| |||..||  ..:..|:||..:.|.:|:.:.|..:..::..:.:...:||.
  Fly   147 ----------VEGR-KHKFGKK--GGLEALVAAGVMMKGMLMAMGLGAIALMAGKALMTALMALT 198

  Fly   144 TSGILALKWILSGGHAHDRLEII-------------------HSHAP 171
            .||:|.||.:..||......||:                   |||:|
  Fly   199 LSGVLGLKSLAGGGGKSTTYEIVAKPIYTSSHSHSVTHEDGGHSHSP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi13NP_649634.1 None
Osi16NP_731065.1 DUF1676 72..156 CDD:285181 19/84 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.