DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi12 and Osi23

DIOPT Version :10

Sequence 1:NP_649631.1 Gene:Osi12 / 40766 FlyBaseID:FBgn0037419 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_651794.2 Gene:Osi23 / 43615 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster


Alignment Length:181 Identity:47/181 - (25%)
Similarity:86/181 - (47%) Gaps:32/181 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CLKKKAISFIDRLAPIDAINVAEGIKLVRLETAPRPPATSENELESSLPRSGSDRDAK-LT--NM 126
            |.:.:::...:.:.....|::.:|::||   .||       |..:::.......:|.| ||  :.
  Fly    57 CFRSRSLHIFEGIMSSPEISIYDGVRLV---AAP-------NSTDNATRPDDERKDLKHLTWFDQ 111

  Fly   127 LIERLSYFFNGHSLQVSFPKLT----SDEIGRGLEEGRGKMKK----MMGMMMMGMAMKMMGMIP 183
            |...|:.....|:|||:..|||    |.:.......|..::::    |:..||.|:......::|
  Fly   112 LAVSLAKGLTTHTLQVNLGKLTERYLSSDTSNPDPVGSARVRRHRYNMIITMMFGVTALGAILVP 176

  Fly   184 IAMGALYILAGKALIISKIALLLAGIIGLKKL-----------MSGKSSGG 223
            :....|.|::||||:::|:|||||.|.|||::           :.|:..||
  Fly   177 MGFQMLSIVSGKALLLAKMALLLASINGLKRVANNGLHYGLYHVPGEHLGG 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi12NP_649631.1 DUF1676 54..214 CDD:462310 43/159 (27%)
Osi23NP_651794.2 DUF1676 44..207 CDD:462310 43/159 (27%)

Return to query results.
Submit another query.