DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi12 and Osi20

DIOPT Version :9

Sequence 1:NP_649631.1 Gene:Osi12 / 40766 FlyBaseID:FBgn0037419 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_649641.1 Gene:Osi20 / 40777 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster


Alignment Length:305 Identity:70/305 - (22%)
Similarity:119/305 - (39%) Gaps:107/305 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SLL----SVLFLASS--CGAATEQLGSPPGPSPSQSAGARTLLRVYDECTRAEAGFVPCLKKKAI 71
            |||    ::|.:||:  .|||.|...:|...|..:     .:..:.|:|..|.|  :.|||:|.:
  Fly     7 SLLAFGCALLLVASTSVSGAAIENAVTPRIHSSDE-----LISTIVDKCFHANA--MHCLKEKVL 64

  Fly    72 SFIDRLAPIDAINVAEGIKLVRLETAPRPPATSENELESSLPRSGSDR---DAKLTNMLIERLSY 133
            :::|.:|     ||.|.:                           |.|   |..:..::::||..
  Fly    65 TYLDTVA-----NVEEEV---------------------------SGRALGDDVIDKVIVDRLGR 97

  Fly   134 FFNGHSLQVSFPK------LTSDEIGRGL------EEGRGKMK---KMMGMMMMGMAMKMMGMIP 183
            ..|.:.:::..|:      :.:....||.      :|||.:.|   |:...:::.|..|:..::|
  Fly    98 ILNTNEMRLQLPQTFFAGSVVTYRSDRGFDLELPKDEGRAEKKNKDKLFLPLLLLMKFKLKVIMP 162

  Fly   184 IAMGALYILAGKALIISKIAL-LLAGII---------GLKKLM----------------SGKSSG 222
            |.:..:.:.|.||||:||||: |:.|.:         |:|..|                :..||.
  Fly   163 ILLALIGLKATKALILSKIAIKLVLGFLIYNLIQKLGGMKMNMVPMPAPVPASEYGVPSTTASSY 227

  Fly   223 GSSGWSSGGGGGGGGWSSGGGGGGGGGWDRRSLTEAQELAYRAHH 267
            ..|.|....||....|.|                  |.|||.::|
  Fly   228 DPSSWEPMSGGPYARWDS------------------QNLAYSSYH 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi12NP_649631.1 DUF1676 74..159 CDD:285181 14/99 (14%)
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 14/94 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.