DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi12 and Osi18

DIOPT Version :9

Sequence 1:NP_649631.1 Gene:Osi12 / 40766 FlyBaseID:FBgn0037419 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_649639.1 Gene:Osi18 / 40775 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster


Alignment Length:230 Identity:53/230 - (23%)
Similarity:100/230 - (43%) Gaps:50/230 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LISLLSVLFLASSCGAATEQLGSPPGPSPSQSAGARTLLRVYDECTRAEAGFVPCLKKKAISFID 75
            ||..|:.|..|.|  |.||      |....||| .:..|.:|..|.:..:  |.|::.||:.:.:
  Fly     8 LIVALAALSTAHS--APTE------GQVAPQSA-TQLALDMYHGCLKDLS--VSCVRPKALQWFN 61

  Fly    76 RLAPIDAINVAEGIKLVRLETAPRPPATSENELESSLPRSGSDRDAKLTNMLIERLSYFFNGHSL 140
            .......:.:.|.:.:||  ||.:..:.|.|..|                .|.:.:..:...|||
  Fly    62 SALRQPEVRITERLSIVR--TAEKVESRSMNPEE----------------RLFDDIDSYLGSHSL 108

  Fly   141 QVSFPK--------------LTSDEIGRG-------LEEGRGKMKKMMGMMMMGMAMKMMGMIPI 184
            ::..|:              |.|:.:.:|       ..||||.::|.:...::|:.:|...::|:
  Fly   109 RIQAPEYFRTSEARSLVPDFLMSNPLTQGGLVPLAAANEGRGMIRKAVLPFLLGLKLKTTVLVPL 173

  Fly   185 AMGALYILAGKALIISKIALLLAGIIGLKKLMSGK 219
            |:|.:.:...||:.:..::|:|:|.:.:.|:...|
  Fly   174 ALGLIALKTWKAMTLGLLSLVLSGALVIFKIAKPK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi12NP_649631.1 DUF1676 74..159 CDD:285181 16/105 (15%)
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 21/115 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.