DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi12 and Osi15

DIOPT Version :9

Sequence 1:NP_649631.1 Gene:Osi12 / 40766 FlyBaseID:FBgn0037419 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_649636.1 Gene:Osi15 / 40771 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster


Alignment Length:260 Identity:60/260 - (23%)
Similarity:98/260 - (37%) Gaps:75/260 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VLFLAS-SCGAATEQLGSPPGPSPSQSAGARTLLRVYDECTRAEAGFVPCLKKKAISFIDRLAPI 80
            |:.||| .||:..         .|||....|.|                      ::.::||...
  Fly     8 VVLLASLVCGSMA---------LPSQDNTERDL----------------------VNMLNRLDSE 41

  Fly    81 DAINVAEGIKLVRLETAPRPPATSENELESSLPRSGSDRDA-KLTNMLIERLSYFFNGHSLQVSF 144
            :::.:..|:::.|.|                   ||....| |......:|...:...|.|.:||
  Fly    42 ESVALFGGLRIDRSE-------------------SGRSFGASKAVESFEDRAERYLETHELNLSF 87

  Fly   145 PKLTSDE------IGRGLEEGRGK-MKKMMGMMMMGMAMKMMGMIPIAMGALYILAGKALIISKI 202
            .....||      .||.::|.|.| ||||:..:::.:.:|...::.|....:..::.|||.||.:
  Fly    88 SGDEQDENSENEYTGRAMDESRSKRMKKMLLPLLLALKLKKAVVVKIMFTIIKFISLKALAISFL 152

  Fly   203 ALLLAGIIGLKKLMSGKSSGGSSGWSSGGGGGG----GGWSSGGGGGGGGGWDRRSLTEAQELAY 263
            ||:|||....|.|::.|....::.:.:|.....    ..||..|..|            |.:|||
  Fly   153 ALILAGATFFKDLLAKKKEHITTAYITGSPLNADIVHSDWSRNGQAG------------AADLAY 205

  Fly   264  263
              Fly   206  205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi12NP_649631.1 DUF1676 74..159 CDD:285181 18/91 (20%)
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 38/172 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.