DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi12 and Osi9

DIOPT Version :9

Sequence 1:NP_649631.1 Gene:Osi12 / 40766 FlyBaseID:FBgn0037419 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_649628.2 Gene:Osi9 / 40763 FlyBaseID:FBgn0037416 Length:233 Species:Drosophila melanogaster


Alignment Length:278 Identity:86/278 - (30%)
Similarity:137/278 - (49%) Gaps:65/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LISLLSVLFLASSCGAATEQLGSPPGPSPSQSAGARTLLRVYDECTRAEAGFVPCLKKKAISFID 75
            :...:.:..|.:|..|||.:..|.          ..:.|::..:|  .|...|.|:|::|:.:.|
  Fly     1 MFKFVCLFALIASTAAATSEADSL----------LTSALKMVKDC--GERSMVLCMKERALHYFD 53

  Fly    76 RLAPIDAINVAEGIKLVRLETAPRPPATSENELESSLPRSGSDRDAKLTNMLIERLSYFFNGHSL 140
              |....:.:.|||.||:  |...|...|.||::  ||.....|:|::.::|:||::.||..|:|
  Fly    54 --AENGDVRLTEGIALVK--TDEIPVGRSLNEMQ--LPEEVEAREAEVDSLLVERVARFFGTHTL 112

  Fly   141 QVSFPKLTSDEIGRGLEEGRGKMKK----MMGMMMMGMAMKMMGMIPIAMGALYILAGKALIISK 201
            |...||.:..::.|.|||.|||.|:    :|.::|: ..:||..::|:|:|.|.:::.|||:|.|
  Fly   113 QFKVPKDSIQDMQRALEESRGKKKEKKKYLMPLLML-FKLKMAALLPLAIGFLALISFKALVIGK 176

  Fly   202 IALLLAGIIGLKKLMSGKSSG------------GSSGWSSGGGGGGGGWSSGGGGGGGGGWDRRS 254
            |||||:||||||||:..|...            .|.|                          ||
  Fly   177 IALLLSGIIGLKKLLESKKENYEVVAHPHYEHEHSYG--------------------------RS 215

  Fly   255 L----TEAQELAYRAHHQ 268
            |    ::||:|||.|:.|
  Fly   216 LPSDDSQAQQLAYAAYKQ 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi12NP_649631.1 DUF1676 74..159 CDD:285181 29/84 (35%)
Osi9NP_649628.2 DUF1676 54..144 CDD:285181 33/93 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AK5C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.