DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi12 and Osi5

DIOPT Version :9

Sequence 1:NP_649631.1 Gene:Osi12 / 40766 FlyBaseID:FBgn0037419 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_649624.1 Gene:Osi5 / 40759 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster


Alignment Length:278 Identity:69/278 - (24%)
Similarity:103/278 - (37%) Gaps:94/278 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IFKQWPWQALISLLSVLFL----ASSCGAATEQLGSPPGPSPSQSAGA-------RTLLRVYDEC 55
            :|:.:|      ||.:|||    :.:|               .|.|||       |.|..|....
  Fly     1 MFRTFP------LLCLLFLTAVRSENC---------------DQDAGATLYCRGERALRNVLRNL 44

  Fly    56 TRAEAGFVPCLKKKAISFIDRLAPIDAINVAEGIKLVRLETAPRPPATSENELESSLPRSGSDRD 120
            .|::...|                     |..|:::|.|:.                 .|.||.:
  Fly    45 NRSDKPLV---------------------VIRGLEIVPLQN-----------------NSISDEE 71

  Fly   121 AKLTNMLIERLSYFFNGHSLQVSFPKLTSDEI----GRGLEEGRGKMKKMMGMMMMGMAMKMMGM 181
            ......|::.||::...|.:.|....|..||.    .|..::|:|.:..|  .:|.|..|.:|| 
  Fly    72 PDQEQGLLDSLSFYLRTHEINVKLADLLEDESQVSEARKKDKGQGMLLAM--ALMFGKMMAVMG- 133

  Fly   182 IPIAMGALYILAGKALIISKIALLLAGIIGLKKLMSGKSSGGSSGWSSGGGGGGGGWSSGGGGGG 246
                :|.:..||.|||.:|.:||::||::|||   :....||.|..|          .|...|.|
  Fly   134 ----LGGIAALAMKALGVSLVALMMAGMLGLK---TAAQHGGESSHS----------ISYVTGEG 181

  Fly   247 GGGWDRRSLTEAQELAYR 264
            .....||..:..|.||||
  Fly   182 HHHKRRRRSSGQQPLAYR 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi12NP_649631.1 DUF1676 74..159 CDD:285181 16/88 (18%)
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 17/82 (21%)
RCR 184..>201 CDD:304939 7/16 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.