DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi12 and Osi2

DIOPT Version :9

Sequence 1:NP_649631.1 Gene:Osi12 / 40766 FlyBaseID:FBgn0037419 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001262303.1 Gene:Osi2 / 40756 FlyBaseID:FBgn0037410 Length:390 Species:Drosophila melanogaster


Alignment Length:353 Identity:72/353 - (20%)
Similarity:121/353 - (34%) Gaps:117/353 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EQLGSPPGPSPSQSAGARTLLRVY--------------DECTRAEAGFVPCLKKKAISFIDRLAP 79
            :|......|...:..|..:||.::              ..|...:..  .|.|.:|::..|.:..
  Fly    51 QQFPQAQQPGVGEERGRSSLLSIFGLGNDNDPFLARTNSNCLGGDLS--ECFKTQALNTFDEIFF 113

  Fly    80 IDAINVAEGIKLVRLETAPRPPATSENEL------ESSLPRSGSDRDAKLTNMLIERLSYFFNGH 138
            .|...:::..::|||      |.|.:..|      .|..||...|...:|....:.|...|....
  Fly   114 KDQYKLSDFARVVRL------PETQQRSLLQEPFEYSEEPRGDDDEWNQLLKYGLRRAERFIKST 172

  Fly   139 SLQVSFP-KLTS-----------------DEIGRGLEEG---RGKMKKMMGMMMMGM---AMKMM 179
            :|:|.:| :||.                 |.|..|...|   |.|:|||:..:::.:   .:|::
  Fly   173 ALEVEWPEELTEAGRYEARFIGNDIDGELDLIDDGQRAGHFSRKKLKKMIIPLLLVLKIFKLKLL 237

  Fly   180 GMIPIAMGALYILAGKALIISKIALLLAGIIGLKKLMSGKSSGGSSGWSSGGGGGG--GGWSS-- 240
            ..:|..:|    :||...|:...|::|.|:....||.  :..||..| :.|||..|  ||.::  
  Fly   238 LFLPFILG----IAGLKKILGLAAIVLPGLFAYFKLC--RPPGGVGG-AFGGGLSGLFGGKNTFP 295

  Fly   241 --------------------GGGGGGGGGWDRR-------------------------------S 254
                                ||.||..|.:.|:                               |
  Fly   296 EYNPQGVGAATYYHHHEHFEGGHGGAPGPYYRQEPSFAKPYTDYYSKSYQGQQVQGQQVGGNSVS 360

  Fly   255 LTEAQELAYRAHHQEQVAH---AQSRPQ 279
            ..:.||.||..::......   |:.:||
  Fly   361 FGDPQEAAYNGYYGRNSGKDIVAEQQPQ 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi12NP_649631.1 DUF1676 74..159 CDD:285181 23/108 (21%)
Osi2NP_001262303.1 DUF1676 108..224 CDD:285181 29/121 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.