DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi12 and Osi24

DIOPT Version :10

Sequence 1:NP_649631.1 Gene:Osi12 / 40766 FlyBaseID:FBgn0037419 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_649620.2 Gene:Osi24 / 40755 FlyBaseID:FBgn0037409 Length:533 Species:Drosophila melanogaster


Alignment Length:258 Identity:60/258 - (23%)
Similarity:89/258 - (34%) Gaps:103/258 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PSPSQSAGARTLLRVYDECTRAEAG-------FVPCLKKKAISFIDRLAPID------AINV--- 85
            |.....|||     :|.:.....||       |.|.|            |||      :.||   
  Fly    44 PESELDAGA-----LYSQPLTTMAGQPRNDDTFRPIL------------PIDISPEFISRNVFTK 91

  Fly    86 ---------AEGIKLVRLETAPR-----PPATS--ENELESSLPR------SGSDRDAK-LTNML 127
                     ||....:||..|.|     .|:.|  :.|.|||...      :..|.:.| |.::|
  Fly    92 SGQYRVFQPAESESDLRLAVAMRRRNFKHPSDSPRKQESESSAAAFKNQTITSIDAELKGLEDLL 156

  Fly   128 IERLSYFF-NG---------------HSLQVSFP-KLTSDEI----------GRGLEEGR----G 161
            ::.:..|| ||               ||...|:. |.|:..|          .|..|..|    .
  Fly   157 VDYVEQFFSNGRYEPTPGLVLALQQNHSHPQSYTGKRTTRSILEDTNVELNVPRAFESARLLFFS 221

  Fly   162 KMKKMMGMMMMGMAMKMMGMIPIAMGALYILAGKALIISKIALLLAGIIGLKKLMSGKSSGGS 224
            .:||:|..:.||:.     ::...:.|:::    ..|||.::.|:.     |.:.||  |.||
  Fly   222 GLKKVMWPIYMGLQ-----VLKSVLFAMFL----PTIISSVSRLIG-----KGITSG--SAGS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi12NP_649631.1 DUF1676 54..214 CDD:462310 49/229 (21%)
Osi24NP_649620.2 None

Return to query results.
Submit another query.