DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi11 and Osi20

DIOPT Version :9

Sequence 1:NP_649630.1 Gene:Osi11 / 40765 FlyBaseID:FBgn0037418 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_649641.1 Gene:Osi20 / 40777 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster


Alignment Length:211 Identity:53/211 - (25%)
Similarity:90/211 - (42%) Gaps:39/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 EHLSGKSL-----DALLLERFLNFVHSHQLQVNLPRLLRFGERNVQDWLLHVVGY--------FM 161
            |.:||::|     |.::::|....::::::::.||:....|.         ||.|        .:
  Fly    75 EEVSGRALGDDVIDKVIVDRLGRILNTNEMRLQLPQTFFAGS---------VVTYRSDRGFDLEL 130

  Fly   162 PASESEGRKKKDDKKYLGPFIAAVLLK-TAILKMAYHSIAIVAGKALIVGKIALIISAIIG--LK 223
            |..|....||..||.:| |.:..:..| ..|:.:....|.:.|.||||:.|||  |..::|  :.
  Fly   131 PKDEGRAEKKNKDKLFL-PLLLLMKFKLKVIMPILLALIGLKATKALILSKIA--IKLVLGFLIY 192

  Fly   224 KLVGHDGGEKTTYEIVKHPQVQQSHTYSSSHQGEYDTGGHD---GGSYHRSIDDEMMMQDKAYQA 285
            .|:...||.|.....:..|.....:...|:....||....:   ||.|.|     ...|:.||.:
  Fly   193 NLIQKLGGMKMNMVPMPAPVPASEYGVPSTTASSYDPSSWEPMSGGPYAR-----WDSQNLAYSS 252

  Fly   286 WMPHVAASPSPVAKGS 301
            :.|   :|.|..:.||
  Fly   253 YHP---SSSSSYSSGS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi11NP_649630.1 DUF1676 65..180 CDD:285181 19/82 (23%)
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 15/74 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.