DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi11 and Osi7

DIOPT Version :9

Sequence 1:NP_649630.1 Gene:Osi11 / 40765 FlyBaseID:FBgn0037418 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_649626.1 Gene:Osi7 / 40761 FlyBaseID:FBgn0037414 Length:288 Species:Drosophila melanogaster


Alignment Length:306 Identity:97/306 - (31%)
Similarity:151/306 - (49%) Gaps:52/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GLLIALLLAAFQAWAMEAPSNYNQNST--ESGLLRTVRHIYGQCAYSEDVFWCCKIQGVRLLGRA 68
            |:|..:.|:|  |...|....:.:|:.  |:.::.:   ||..|...:.|. |.|.:....:.:.
  Fly     9 GVLCLVALSA--ALPAEETRGHARNAIGGENDIMDS---IYSDCLRKDSVS-CVKYKLFSFVDKV 67

  Fly    69 LKV-PQLGIVDGVSLVRRESFTQDTRSGRSSLLESQLSNRDLEHLSG-KSLDALLLERFLNFVHS 131
            |.. .|..:.:||::||.....|. .:.||              :|| :|.::|.|.|..:|::|
  Fly    68 LGARDQFALTEGVTVVRSPDAPQQ-EAARS--------------ISGDESFESLALNRISSFLNS 117

  Fly   132 HQLQVNLP-----RLLRFGERNVQDWLLHVVGYFMPASESEGR-KKKDDKKYLGPFIAAVLLK-T 189
            |.::|.|.     :.:....|.::|....:.|...|.:..|.| |||...|.|||.:|.|.|| .
  Fly   118 HTIKVELKGADIVQAVSSTGRALEDASESLFGSNDPNAPEESRGKKKKAAKILGPILALVALKAA 182

  Fly   190 AILKMAYHSIAIVAGKALIVGKIALIISAIIGLKKLVGHDGGEKTTYEIVKHPQVQQSH-----T 249
            |:|.:...:||::|||||::|||||::||:||||||:..:  :..|||:|.||....||     :
  Fly   183 ALLPLLLGAIALIAGKALLIGKIALVLSAVIGLKKLLSQE--KHVTYEVVAHPHHSSSHSTSHDS 245

  Fly   250 YSSSHQGE-------YDTGGHDGGSYHRSIDDEMMMQDKAYQAWMP 288
            |.|.:..:       |.:.||  |.:.||||    .||.||.|..|
  Fly   246 YGSGYSADAGASSASYGSSGH--GGWGRSID----AQDLAYGAQKP 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi11NP_649630.1 DUF1676 65..180 CDD:285181 31/122 (25%)
Osi7NP_649626.1 DUF1676 46..217 CDD:400313 60/186 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AK5C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.