DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi11 and Osi6

DIOPT Version :9

Sequence 1:NP_649630.1 Gene:Osi11 / 40765 FlyBaseID:FBgn0037418 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001287192.1 Gene:Osi6 / 40760 FlyBaseID:FBgn0027527 Length:312 Species:Drosophila melanogaster


Alignment Length:282 Identity:70/282 - (24%)
Similarity:111/282 - (39%) Gaps:65/282 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YGQCAYSEDVFWCCKIQGVRLLGRALKVPQLGIVDGVSLVRRESFTQDTRSGRSSLLESQLSNRD 108
            :.||..|:.:. |.::...|........||:.:..|||||:    :.:.|.|:|  |::.|:...
  Fly    58 FAQCLESDSIS-CLQLTLFRKAKSVFDNPQIELFGGVSLVK----SNEGRQGKS--LDNSLAVEA 115

  Fly   109 LEHLSGKSLD----------ALLLERFLNFVHSHQLQVNLPRLLRFGERNVQD----WLLHVVGY 159
            ...:..::.:          :...||.|||        |.....|...|.:.|    .|..:|  
  Fly   116 APTVEARTAEMGNYFMDNAKSFFAERSLNF--------NFANAARSVARAIPDDIKADLRELV-- 170

  Fly   160 FMPASESEGRKKKDDKKYLGPFIAAVLLKTAILKM-AYHSIAIVAGKALIVGKIALIIS----AI 219
                .||..||||..||:| |.:..|..|.|:|.: :...:..:|.|||:|..||..::    |.
  Fly   171 ----VESRTRKKKLLKKFL-PILLGVGAKIAVLGVGSIFGLLFLAKKALVVSVIAFFLALAAGAS 230

  Fly   220 IGLKKLVGHDGGEKTTYEIVKHPQVQQSHTYSSSHQGEYDTGG-------HDGGSYHRSIDDEMM 277
            .||.::.|..||......:......:.:...|::..|.:.:||       ..|||          
  Fly   231 SGLGRIGGSGGGGGLLGGLGGLFGGKNAGGSSAASTGGWSSGGGASSAGWSSGGS---------- 285

  Fly   278 MQDKAYQAWMPHVAASPSPVAK 299
                  ..|..|.|.| ||||:
  Fly   286 ------SGWDTHGAYS-SPVAQ 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi11NP_649630.1 DUF1676 65..180 CDD:285181 32/128 (25%)
Osi6NP_001287192.1 DUF1676 81..176 CDD:285181 25/114 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.