DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi11 and Osi4

DIOPT Version :9

Sequence 1:NP_649630.1 Gene:Osi11 / 40765 FlyBaseID:FBgn0037418 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001262305.1 Gene:Osi4 / 40758 FlyBaseID:FBgn0037412 Length:395 Species:Drosophila melanogaster


Alignment Length:188 Identity:41/188 - (21%)
Similarity:68/188 - (36%) Gaps:67/188 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 RKKKDDKKYLGPFIAAVLLKTAI--LKMAYHSIAIVAGKALIVGKIALIISAIIGLKKLVGHDGG 231
            |.:..|||....||...|..|..  ..:|..::.::..||||:.|||.:::||:.:|||: .:..
  Fly   204 RHQHQDKKQFQMFIPMYLAATTFGWTMVAAKAVGLLTLKALILSKIAFVVAAIVLIKKLM-DNAS 267

  Fly   232 EKTTYEIVK--------------------------------------------HPQVQ----QSH 248
            ||..|:..:                                            ||.::    :||
  Fly   268 EKMMYQFPEQTPYMMPYGMDYPLHGAEISPEMYPSSLHHLAMAGGGQLPGHPGHPGLESLSAESH 332

  Fly   249 TYSS--SHQGEYDT------GGHDGGSYHRSIDDEMMMQDKA--------YQAWMPHV 290
            .:|:  |..|..:|      ||..|..:....:|..|.:.|:        |....||:
  Fly   333 LHSAQVSSDGSNNTQVLAALGGLGGLGHKIKREDSWMAKSKSTPARRPLIYNYVQPHM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi11NP_649630.1 DUF1676 65..180 CDD:285181 4/10 (40%)
Osi4NP_001262305.1 DUF1676 <210..261 CDD:311725 16/50 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.