DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi10b and Osi19

DIOPT Version :9

Sequence 1:NP_001368993.1 Gene:Osi10b / 40764 FlyBaseID:FBgn0286977 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_649640.1 Gene:Osi19 / 40776 FlyBaseID:FBgn0037429 Length:266 Species:Drosophila melanogaster


Alignment Length:260 Identity:56/260 - (21%)
Similarity:106/260 - (40%) Gaps:60/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SPRSLGRIIAH----CMGGADAWQCLGSESEQLLDGATRDNSTWQITDYLSI----EPKVGISKP 92
            |...:.|:||.    |..|.|:..|:...:.:.:|.....:| :|::: |.:    |....|::.
  Fly    24 STEKMQRLIAEEQNKCASGQDSMACIKERAMRFVDNVMSKDS-FQVSN-LEVRSNGEKTTPINEA 86

  Fly    93 ETRRMDMGLPGKLLELVQGRALRLQLP---RQLTIS--NAID-----------DFGSELGLD--- 138
            .....| |....:...::|..:.:.||   .::|:|  |.::           |.|.| |.|   
  Fly    87 RASSAD-GFLDAIENYIRGHDVSMDLPLADAKVTVSARNLVNNQLSLNLQLNGDDGDE-GTDVEA 149

  Fly   139 QGRK-------KKDKDKNMAMMGGMIMM---ATLAQMFLGKVILIAGSAFIMAKIALVIS----L 189
            :|:|       ||.:.:.:||...::::   .|:..|.:|.:.:.|.:|..:...:.::|    :
  Fly   150 RGKKGNIFKKGKKHRLRKLAMPILVLILLKAITVIPMAIGILKIKAFNALALGFFSFIVSVGLAI 214

  Fly   190 LGSLKKGSTGHSGSGGGSGTEHVVVHSSHESGWHRSMPTHDTYSQLDQVEEP-PLGSHMEYYQAY 253
            ....||.:..|      ..|.|:..|...:.....|:|.       ..||:| .||..:. ||||
  Fly   215 FQLCKKIAHDH------HHTAHITAHGPWDGRTFSSVPA-------PVVEQPQKLGQALA-YQAY 265

  Fly   254  253
              Fly   266  265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi10bNP_001368993.1 DUF1676 52..195 CDD:400313 33/179 (18%)
Osi19NP_649640.1 DUF1676 57..163 CDD:285181 22/109 (20%)
DUF3671 <152..216 CDD:289205 11/63 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.