DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi10b and Osi17

DIOPT Version :10

Sequence 1:NP_001368993.1 Gene:Osi10b / 40764 FlyBaseID:FBgn0286977 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001262307.1 Gene:Osi17 / 40774 FlyBaseID:FBgn0037427 Length:750 Species:Drosophila melanogaster


Alignment Length:120 Identity:23/120 - (19%)
Similarity:43/120 - (35%) Gaps:47/120 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 SGGGSGTEHV----------------VVHSSHESG----W---------HRSMPTHDTYSQLDQV 238
            ||.|.|:|::                ..|.::::|    |         |::...|..:|...|.
  Fly   435 SGPGLGSEYIGDINRVAQIEENAHFFKPHPANDAGVLHAWGLGTTQQAQHQTHQPHQRWSVTQQA 499

  Fly   239 EEPPLGSHMEYYQAYQMEPLKRRLH------QAAAYPDQP---------RPEATK 278
            ..|   :.::..|..|.:.||.::.      ||:::...|         ||..|:
  Fly   500 RPP---TQLKQQQTQQQQQLKLQMQLSAQKVQASSHSLNPFQSQDKQSSRPAHTQ 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi10bNP_001368993.1 DUF1676 52..195 CDD:462310
Osi17NP_001262307.1 DUF1676 162..>271 CDD:462310
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.