DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi10b and Osi8

DIOPT Version :9

Sequence 1:NP_001368993.1 Gene:Osi10b / 40764 FlyBaseID:FBgn0286977 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_649627.1 Gene:Osi8 / 40762 FlyBaseID:FBgn0037415 Length:274 Species:Drosophila melanogaster


Alignment Length:283 Identity:76/283 - (26%)
Similarity:117/283 - (41%) Gaps:55/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRVVLLQ---CFVFGSSVLSLSHKG-------------NETSANASTSPWSPRSL-GRIIAHCM 48
            :|.|..|.   |::..:...|..|:.             |......||..|...|: .||...| 
  Fly     5 VWHVAALMIVFCWLSSARSASYQHQNPNSLSSAPRPQVQNSNPGMGSTGLWKDMSMVYRIYQQC- 68

  Fly    49 GGADAWQCLGSESEQLLDGATRDNSTWQITDYLSIEPKVGISKPETRRMDMGLPGKLLELVQGRA 113
            .|.:...||..:....|:.|.|...:..:.:.:......|.|: ||:|..  :..|.:|.|    
  Fly    69 SGDNMSVCLKVKLLTGLEKAFRSAKSLSLMEGIQFVSSGGESE-ETKRAP--ISEKDIEAV---- 126

  Fly   114 LRLQLPRQL-------------TISNAIDD------FGSELGLDQGRKKKDKDKNMAM-MGGMIM 158
                |||.:             .:.|.:.|      |.:|....:|||||:|..|.|| |..:::
  Fly   127 ----LPRSVDAKEQVLNNMILKRVGNFLQDHTLQVKFDNEANSVEGRKKKEKKGNGAMIMIPLLL 187

  Fly   159 MATLAQMFLGKVILIAGSAFIMAKIALVISLLGSLKKGSTGHSGSGGGSGTEH-VVVHSSHESGW 222
            ..|:..:..|.:.::||.|.|::|:|||::.:..:||..   ||.|||..:.| |||.|...|||
  Fly   188 GGTIVPLAYGALAMLAGKALIVSKLALVLASIIGIKKLL---SGGGGGKESSHEVVVSSGGHSGW 249

  Fly   223 HRSMPTHDTYSQLDQVEEPPLGS 245
            .|.:.|  .||......:...||
  Fly   250 GRELDT--AYSGWKPAAKESAGS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi10bNP_001368993.1 DUF1676 52..195 CDD:400313 40/162 (25%)
Osi8NP_649627.1 DUF1676 85..>169 CDD:285181 18/94 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.