DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi9 and Osi23

DIOPT Version :9

Sequence 1:NP_649628.2 Gene:Osi9 / 40763 FlyBaseID:FBgn0037416 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_651794.2 Gene:Osi23 / 43615 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster


Alignment Length:230 Identity:59/230 - (25%)
Similarity:104/230 - (45%) Gaps:43/230 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LIASTAAATSEADSLLTSALKM----VKDCGE----RSMVLCMKERALHYFDA--ENGDVRLTEG 64
            |:...||....||....|.:|.    ::||.:    :|:..|.:.|:||.|:.  .:.::.:.:|
  Fly    16 LVDRYAAGEDLADKSWISQMKKLRSDLRDCYQSGIHQSLWSCFRSRSLHIFEGIMSSPEISIYDG 80

  Fly    65 IALVKTDEIPVGRSLNEMQLPEEVEAREAE----VDSLLVERVARFFGTHTLQFKVPKDSIQDMQ 125
            :.||...     .|.:....|:: |.::.:    .|.|.|. :|:...|||||..:.|.:    :
  Fly    81 VRLVAAP-----NSTDNATRPDD-ERKDLKHLTWFDQLAVS-LAKGLTTHTLQVNLGKLT----E 134

  Fly   126 RALEESRGK-------KKEKKKYLMPLLMLFKLKM--AALLPLAIGFLALISFKALVIGKIALLL 181
            |.|......       :..:.:|.|.:.|:|.:..  |.|:|:....|:::|.|||::.|:||||
  Fly   135 RYLSSDTSNPDPVGSARVRRHRYNMIITMMFGVTALGAILVPMGFQMLSIVSGKALLLAKMALLL 199

  Fly   182 SGIIGLKKLLESKKENYEVVAHPHYEHEHSYGRSL 216
            :.|.|||::..:..         ||...|..|..|
  Fly   200 ASINGLKRVANNGL---------HYGLYHVPGEHL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi9NP_649628.2 DUF1676 54..144 CDD:285181 19/102 (19%)
Osi23NP_651794.2 DUF1676 66..163 CDD:285181 21/107 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.