DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi9 and Osi20

DIOPT Version :9

Sequence 1:NP_649628.2 Gene:Osi9 / 40763 FlyBaseID:FBgn0037416 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_649641.1 Gene:Osi20 / 40777 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster


Alignment Length:273 Identity:68/273 - (24%)
Similarity:121/273 - (44%) Gaps:69/273 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFVCLFALIASTAAATSEADSLLTSAL--------KMVKDCGERSMVLCMKERALHYFDAENG 57
            :..|.|...|:|||:.:.:..::.:|..:        .:|..|...:.:.|:||:.|.|.|    
  Fly     8 LLAFGCALLLVASTSVSGAAIENAVTPRIHSSDELISTIVDKCFHANAMHCLKEKVLTYLD---- 68

  Fly    58 DVRLTEGIALVKTDEIPVGRSLNEMQLPEEVEAREAEVDSLLVERVARFFGTHTLQFKVPK---- 118
                    .:...:|...||:|.     ::|      :|.::|:|:.|...|:.::.::|:    
  Fly    69 --------TVANVEEEVSGRALG-----DDV------IDKVIVDRLGRILNTNEMRLQLPQTFFA 114

  Fly   119 --------DSIQDMQRALEESRGKKKEKKKYLMPLLMLFKLKMAALLPLAIGFLALISFKALVIG 175
                    |...|::...:|.|.:||.|.|..:|||:|.|.|:..::|:.:..:.|.:.|||::.
  Fly   115 GSVVTYRSDRGFDLELPKDEGRAEKKNKDKLFLPLLLLMKFKLKVIMPILLALIGLKATKALILS 179

  Fly   176 KIAL-LLSG--IIGLKKLLESKKENYEVVAHPHYEHEHSYGRSLPS------DDS---------- 221
            |||: |:.|  |..|.:.|...|.|  :|..|.......||  :||      |.|          
  Fly   180 KIAIKLVLGFLIYNLIQKLGGMKMN--MVPMPAPVPASEYG--VPSTTASSYDPSSWEPMSGGPY 240

  Fly   222 ---QAQQLAYAAY 231
               .:|.|||::|
  Fly   241 ARWDSQNLAYSSY 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi9NP_649628.2 DUF1676 54..144 CDD:285181 19/101 (19%)
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 16/78 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.