DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi9 and Osi15

DIOPT Version :9

Sequence 1:NP_649628.2 Gene:Osi9 / 40763 FlyBaseID:FBgn0037416 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_649636.1 Gene:Osi15 / 40771 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster


Alignment Length:249 Identity:73/249 - (29%)
Similarity:101/249 - (40%) Gaps:64/249 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFVCLFALIASTAAATSEADSLLTSALKMVKDCGERSMVLCMKERALHYFDAENGDVRLTEGIAL 67
            ||||: .|:||....:....|         :|..||.:|     ..|:..|:|       |.:||
  Fly     4 KFVCV-VLLASLVCGSMALPS---------QDNTERDLV-----NMLNRLDSE-------ESVAL 46

  Fly    68 ---VKTDEIPVGRSLNEMQLPEEVEAREAEVDSLLVERVARFFGTHTLQFKVPKDSIQDMQ---- 125
               ::.|....|||....:..|..|           :|..|:..||.|......|. ||..    
  Fly    47 FGGLRIDRSESGRSFGASKAVESFE-----------DRAERYLETHELNLSFSGDE-QDENSENE 99

  Fly   126 ---RALEESRGKKKEKKKYLMPLLMLFKLKMAALLPLAIGFLALISFKALVIGKIALLLSGIIGL 187
               ||::|||.|:  .||.|:|||:..|||.|.::.:....:..||.|||.|..:||:|:|....
  Fly   100 YTGRAMDESRSKR--MKKMLLPLLLALKLKKAVVVKIMFTIIKFISLKALAISFLALILAGATFF 162

  Fly   188 KKLLESKKENYEVVAHPHYEHEHSYGRSLPSD----------DSQAQQLAYAAY 231
            |.||..|||        |....:..|..|.:|          .:.|..|||..|
  Fly   163 KDLLAKKKE--------HITTAYITGSPLNADIVHSDWSRNGQAGAADLAYNHY 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi9NP_649628.2 DUF1676 54..144 CDD:285181 27/99 (27%)
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 47/157 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.