DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi9 and Osi11

DIOPT Version :9

Sequence 1:NP_649628.2 Gene:Osi9 / 40763 FlyBaseID:FBgn0037416 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_649630.1 Gene:Osi11 / 40765 FlyBaseID:FBgn0037418 Length:302 Species:Drosophila melanogaster


Alignment Length:217 Identity:73/217 - (33%)
Similarity:107/217 - (49%) Gaps:52/217 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LTEGIALVK----TDEIPVGR-SLNEMQLPEEVEAREAE------VDSLLVERVARFFGTHTLQF 114
            :.:|::||:    |.:...|| ||.|.||..    |:.|      :|:||:||...|..:|.||.
  Fly    76 IVDGVSLVRRESFTQDTRSGRSSLLESQLSN----RDLEHLSGKSLDALLLERFLNFVHSHQLQV 136

  Fly   115 KVPK------DSIQD--------MQRALEESRGKKKEKKKYLMPLLMLFKLKMAALLPLAIGFLA 165
            .:|:      .::||        ...|.|....|||:.||||.|.:....|| .|:|.:|...:|
  Fly   137 NLPRLLRFGERNVQDWLLHVVGYFMPASESEGRKKKDDKKYLGPFIAAVLLK-TAILKMAYHSIA 200

  Fly   166 LISFKALVIGKIALLLSGIIGLKKLL---ESKKENYEVVAHPHYEHEH----------------- 210
            :::.|||::|||||::|.|||||||:   ..:|..||:|.||..:..|                 
  Fly   201 IVAGKALIVGKIALIISAIIGLKKLVGHDGGEKTTYEIVKHPQVQQSHTYSSSHQGEYDTGGHDG 265

  Fly   211 -SYGRSLPSDDSQAQQLAYAAY 231
             ||.||: .|:...|..||.|:
  Fly   266 GSYHRSI-DDEMMMQDKAYQAW 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi9NP_649628.2 DUF1676 54..144 CDD:285181 34/107 (32%)
Osi11NP_649630.1 DUF1676 65..180 CDD:285181 34/107 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AK5C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.