DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi9 and Osi10b

DIOPT Version :9

Sequence 1:NP_649628.2 Gene:Osi9 / 40763 FlyBaseID:FBgn0037416 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001368993.1 Gene:Osi10b / 40764 FlyBaseID:FBgn0286977 Length:284 Species:Drosophila melanogaster


Alignment Length:161 Identity:45/161 - (27%)
Similarity:73/161 - (45%) Gaps:41/161 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 EIPVGRSLNEMQLPEEVEAREAEVDSLLVERVARFFGTHTLQFKVPKDSIQDMQRALEESRGKKK 136
            |:..||:| .:|||.::....|..|          ||:               :..|::.| |||
  Fly   107 ELVQGRAL-RLQLPRQLTISNAIDD----------FGS---------------ELGLDQGR-KKK 144

  Fly   137 EKKKYLMPLLMLFKLKMAALLPLAIGFLALISFKALVIGKIALLLSGIIGLKKLLE--------S 193
            :|.|.:  .:|...:.||.|..:.:|.:.||:..|.::.||||::|.:..|||...        |
  Fly   145 DKDKNM--AMMGGMIMMATLAQMFLGKVILIAGSAFIMAKIALVISLLGSLKKGSTGHSGSGGGS 207

  Fly   194 KKENYEVVAHPHYEHEHSYGRSLPSDDSQAQ 224
            ..|:..|    |..||..:.||:|:.|:.:|
  Fly   208 GTEHVVV----HSSHESGWHRSMPTHDTYSQ 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi9NP_649628.2 DUF1676 54..144 CDD:285181 18/71 (25%)
Osi10bNP_001368993.1 DUF1676 52..195 CDD:400313 32/116 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.