DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi7 and Osi23

DIOPT Version :9

Sequence 1:NP_649626.1 Gene:Osi7 / 40761 FlyBaseID:FBgn0037414 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_651794.2 Gene:Osi23 / 43615 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster


Alignment Length:219 Identity:48/219 - (21%)
Similarity:106/219 - (48%) Gaps:39/219 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NDIMDSIYSDCLRKDSVSCVKYKLFSFVDKVLGARDQFALTEGVTVVRSPDA------PQQEAAR 95
            :|:.| .|...:.:...||.:.:.....:.::.: .:.::.:||.:|.:|::      |..| .:
  Fly    40 SDLRD-CYQSGIHQSLWSCFRSRSLHIFEGIMSS-PEISIYDGVRLVAAPNSTDNATRPDDE-RK 101

  Fly    96 SISGDESFESLALNRISSFLNSHTIKVELKGADIVQAVSSTGRALEDASESLFGSNDPNAPEESR 160
            .:.....|:.||:: ::..|.:||::|.|            |:..|....|  .:::|:....:|
  Fly   102 DLKHLTWFDQLAVS-LAKGLTTHTLQVNL------------GKLTERYLSS--DTSNPDPVGSAR 151

  Fly   161 GKKKKAAKILGPILALVALKAAALLPLLLGAIALIAGKALLIGKIALVLSAVIGLKKLLSQEKHV 225
            .::.:...|:..:..:.|| .|.|:|:....:::::|||||:.|:||:|:::.|||::.:...|.
  Fly   152 VRRHRYNMIITMMFGVTAL-GAILVPMGFQMLSIVSGKALLLAKMALLLASINGLKRVANNGLHY 215

  Fly   226 -TYEV-------------VAHPHH 235
             .|.|             |:||.:
  Fly   216 GLYHVPGEHLGGYYDRGDVSHPRN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi7NP_649626.1 DUF1676 46..217 CDD:400313 38/176 (22%)
Osi23NP_651794.2 DUF1676 66..163 CDD:285181 20/113 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.