DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi7 and Osi20

DIOPT Version :9

Sequence 1:NP_649626.1 Gene:Osi7 / 40761 FlyBaseID:FBgn0037414 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_649641.1 Gene:Osi20 / 40777 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster


Alignment Length:305 Identity:68/305 - (22%)
Similarity:127/305 - (41%) Gaps:80/305 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VTFGVLCLVALSAALPAEETRGHARNAIGGENDIMDSIYSDCLRKDSVSCVKYKLFSFVDKVLGA 70
            :.||...|:..|.::............|...::::.:|...|...:::.|:|.|:.:::|.|...
  Fly     9 LAFGCALLLVASTSVSGAAIENAVTPRIHSSDELISTIVDKCFHANAMHCLKEKVLTYLDTVANV 73

  Fly    71 RDQFALTEGVTVVRSPDAPQQEAARSISGDESFESLALNRISSFLNSHTIKVELK----GADIVQ 131
                               ::|.:....||:..:.:.::|:...||::.::::|.    ...:|.
  Fly    74 -------------------EEEVSGRALGDDVIDKVIVDRLGRILNTNEMRLQLPQTFFAGSVVT 119

  Fly   132 AVSSTGRALEDASESLFGSNDPNAP-EESRGKKKKAAKILGPILALVALKAAALLPLLLGAIALI 195
            ..|..|..||             .| :|.|.:||...|:..|:|.|:..|...::|:||..|.|.
  Fly   120 YRSDRGFDLE-------------LPKDEGRAEKKNKDKLFLPLLLLMKFKLKVIMPILLALIGLK 171

  Fly   196 AGKALLIGKIALVLSAVIG------LKKLLSQEKHV--------------------TYE------ 228
            |.|||::.|||:.|  |:|      ::||...:.::                    :|:      
  Fly   172 ATKALILSKIAIKL--VLGFLIYNLIQKLGGMKMNMVPMPAPVPASEYGVPSTTASSYDPSSWEP 234

  Fly   229 VVAHPH---------HSSSHSTSHDSYGSGYSADAGASSASYGSS 264
            :...|:         :||.|.:|..||.||.|:.:..||:||.||
  Fly   235 MSGGPYARWDSQNLAYSSYHPSSSSSYSSGSSSGSSGSSSSYSSS 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi7NP_649626.1 DUF1676 46..217 CDD:400313 43/181 (24%)
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 16/99 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.