DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi7 and Osi10b

DIOPT Version :9

Sequence 1:NP_649626.1 Gene:Osi7 / 40761 FlyBaseID:FBgn0037414 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001368993.1 Gene:Osi10b / 40764 FlyBaseID:FBgn0286977 Length:284 Species:Drosophila melanogaster


Alignment Length:140 Identity:41/140 - (29%)
Similarity:56/140 - (40%) Gaps:37/140 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 ALEDASESLFGSN-DPNAPEESRGKKKKAAKILGPILALVALKAAALLPLLLGAIALIAGKALLI 202
            |::|     |||. ..:...:.:.|.|..|.:.|.|:      .|.|..:.||.:.||||.|.::
  Fly   127 AIDD-----FGSELGLDQGRKKKDKDKNMAMMGGMIM------MATLAQMFLGKVILIAGSAFIM 180

  Fly   203 GKIALVLSAVIGLKKLLSQEKHVTYEVVAHPHHSSSHSTSHDSYGSGYSADAGASSASYGSSGHG 267
            .|||||:|.:..|||                     .||.|...|.|    :|.......||...
  Fly   181 AKIALVISLLGSLKK---------------------GSTGHSGSGGG----SGTEHVVVHSSHES 220

  Fly   268 GWGRSIDAQD 277
            ||.||:...|
  Fly   221 GWHRSMPTHD 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi7NP_649626.1 DUF1676 46..217 CDD:400313 26/78 (33%)
Osi10bNP_001368993.1 DUF1676 52..195 CDD:400313 26/78 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.