DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi7 and Osi8

DIOPT Version :9

Sequence 1:NP_649626.1 Gene:Osi7 / 40761 FlyBaseID:FBgn0037414 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_649627.1 Gene:Osi8 / 40762 FlyBaseID:FBgn0037415 Length:274 Species:Drosophila melanogaster


Alignment Length:260 Identity:74/260 - (28%)
Similarity:111/260 - (42%) Gaps:78/260 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IYSDCLRKDSVSCVKYKLFSFVDKVLGARDQFALTEGVTVVRS-------PDAPQQE------AA 94
            ||..|...:...|:|.||.:.::|...:....:|.||:..|.|       ..||..|      ..
  Fly    64 IYQQCSGDNMSVCLKVKLLTGLEKAFRSAKSLSLMEGIQFVSSGGESEETKRAPISEKDIEAVLP 128

  Fly    95 RSISGDES-FESLALNRISSFLNSHTIKVELKGADIVQAVSSTGRALEDASESLFGSNDPNAPEE 158
            ||:...|. ..::.|.|:.:||..||::|:.                         .|:.|:.| 
  Fly   129 RSVDAKEQVLNNMILKRVGNFLQDHTLQVKF-------------------------DNEANSVE- 167

  Fly   159 SRGKKKKAAKILGPILALVALKAAALLPLLLGAIALIAGKALLIGKIALVLSAVIGLKKLLS--- 220
              |:|||..|..|.::.:..|....::||..||:|::|||||::.|:||||:::||:|||||   
  Fly   168 --GRKKKEKKGNGAMIMIPLLLGGTIVPLAYGALAMLAGKALIVSKLALVLASIIGIKKLLSGGG 230

  Fly   221 QEKHVTYEVVAHPHHSSSHSTSHDSYGSGYSADAGASSASYGSSGHGGWGRSIDAQDLAYGAQKP 285
            ..|..::|||.                              .|.||.||||.:|.   ||...||
  Fly   231 GGKESSHEVVV------------------------------SSGGHSGWGRELDT---AYSGWKP 262

  Fly   286  285
              Fly   263  262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi7NP_649626.1 DUF1676 46..217 CDD:400313 51/184 (28%)
Osi8NP_649627.1 DUF1676 85..>169 CDD:285181 22/111 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453108
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AK5C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.