DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi7 and Osi6

DIOPT Version :9

Sequence 1:NP_649626.1 Gene:Osi7 / 40761 FlyBaseID:FBgn0037414 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001287192.1 Gene:Osi6 / 40760 FlyBaseID:FBgn0027527 Length:312 Species:Drosophila melanogaster


Alignment Length:326 Identity:82/326 - (25%)
Similarity:119/326 - (36%) Gaps:87/326 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SHKVTFGVLCLVALSAALPAEETRGHARNAIGGENDIMDSIYSDCLRKDSVSCVKYKLFSFVDKV 67
            |.|......|::.|:|.:.|:..:. |....|.        ::.||..||:||::..||.....|
  Fly    26 SMKFFVATACILLLAAGISADPVKA-AEEQPGA--------FAQCLESDSISCLQLTLFRKAKSV 81

  Fly    68 LGARDQFALTEGVTVVRSPD---------------APQQEAARSISGDESFESLALNRISSFLNS 117
            .. ..|..|..||::|:|.:               ||..||..:..|     :..::...||...
  Fly    82 FD-NPQIELFGGVSLVKSNEGRQGKSLDNSLAVEAAPTVEARTAEMG-----NYFMDNAKSFFAE 140

  Fly   118 HTIKVELKGADIVQAVSSTGRALEDASESLFGSNDPNAP-----EESRGKKKKAAKILGPILALV 177
            .::..     :...|..|..||:.|         |..|.     .|||.:|||..|...|||..|
  Fly   141 RSLNF-----NFANAARSVARAIPD---------DIKADLRELVVESRTRKKKLLKKFLPILLGV 191

  Fly   178 ALKAAALLPLLLGAIALIAGKALLIGKIALVLSAVIGLKKLLSQ-------------------EK 223
            ..|.|.|....:..:..:|.|||::..||..|:...|....|.:                   .|
  Fly   192 GAKIAVLGVGSIFGLLFLAKKALVVSVIAFFLALAAGASSGLGRIGGSGGGGGLLGGLGGLFGGK 256

  Fly   224 HVTYEVVAHPHHSSSHSTSHDSYGSGYSADAGASSASYGSSGHGGWG-----RSIDAQDLAYGAQ 283
            :.        ..||:.||      .|:|:..|||||.:.|.|..||.     .|..||.:||...
  Fly   257 NA--------GGSSAAST------GGWSSGGGASSAGWSSGGSSGWDTHGAYSSPVAQTIAYQGY 307

  Fly   284 K 284
            |
  Fly   308 K 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi7NP_649626.1 DUF1676 46..217 CDD:400313 51/190 (27%)
Osi6NP_001287192.1 DUF1676 81..176 CDD:285181 24/114 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.