DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi7 and Osi3

DIOPT Version :9

Sequence 1:NP_649626.1 Gene:Osi7 / 40761 FlyBaseID:FBgn0037414 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001262304.1 Gene:Osi3 / 40757 FlyBaseID:FBgn0037411 Length:288 Species:Drosophila melanogaster


Alignment Length:315 Identity:93/315 - (29%)
Similarity:148/315 - (46%) Gaps:70/315 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TFGVLCLVALSAALPAEETRGHARNAIGG------------ENDIMDSIYSDCLRKDSVSCVKYK 59
            ||.|..|:|....|.:  .||..|.  .|            |:.::..:..:|.::|..:|...|
  Fly     3 TFKVCALLAFCFVLVS--ARGSKRR--DGTVTISESERKNIEDFLLAKLKQNCRQEDDRACKMVK 63

  Fly    60 LFSFVDKV-LGAR----DQFALTEGVTVVRSPDAPQ--QEAARSISGD-ESFESLALNRISSFLN 116
            :...::.: |..|    |:|.:||...:...||.|:  |..:||:..| |:|..|..|::..|:.
  Fly    64 MSIVMNHLYLNTRIDLGDRFKVTENGNISMVPDDPEVNQLLSRSMGSDEETFALLMANKLWKFIR 128

  Fly   117 SHTIKVEL-KGADIVQAVSSTGRALEDASESLFGSNDP-NAPEESRGKKKKAAKILGPILALVAL 179
            |.:::.:. :..|.|  ::|.    .:.|.:|..|..| .|.:|.|||.|.    :||:|.::|.
  Fly   129 SRSLRYKFSENTDFV--INSD----PEGSLNLGVSVRPLEALQEGRGKMKN----MGPLLMMMAA 183

  Fly   180 KAAALLPLLLGAIALIAGKALLIGKIALVLSAVIGLKKLLSQEKHVTYEVVAHPHHSSSHSTSHD 244
            |...:..|||..:.|:|||||::.||||:|:.:|.||||||.:|.:. ||.:|          ||
  Fly   184 KTGMVGALLLKGLFLLAGKALIVSKIALLLAVIISLKKLLSSKKTIV-EVPSH----------HD 237

  Fly   245 SYGSGYS--------------ADAGASSASYGSSGHGGWGRSIDAQDLAYGAQKP 285
            ||.||:|              ||..|....:         :...||::||..|:|
  Fly   238 SYSSGWSRAFDGFVEGLVDVPADILAKEVQH---------QQEQAQNMAYSGQQP 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi7NP_649626.1 DUF1676 46..217 CDD:400313 57/180 (32%)
Osi3NP_001262304.1 DUF1676 68..180 CDD:285181 35/121 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AK5C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.