DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi7 and Osi2

DIOPT Version :9

Sequence 1:NP_649626.1 Gene:Osi7 / 40761 FlyBaseID:FBgn0037414 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001262303.1 Gene:Osi2 / 40756 FlyBaseID:FBgn0037410 Length:390 Species:Drosophila melanogaster


Alignment Length:333 Identity:74/333 - (22%)
Similarity:110/333 - (33%) Gaps:102/333 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ETRGHAR----NAIGGEND-IMDSIYSDCLRKDSVSCVKYKLFSFVDKVLGARDQFALTEGVTVV 83
            |.||.:.    ..:|.:|| .:....|:||..|...|.|.:..:..|::. .:||:.|::...||
  Fly    63 EERGRSSLLSIFGLGNDNDPFLARTNSNCLGGDLSECFKTQALNTFDEIF-FKDQYKLSDFARVV 126

  Fly    84 RSPDAPQQ-------EAARSISGDE----SFESLALNRISSFLNSHTIKVELKGADIVQAVSSTG 137
            |.|:..|:       |.:....||:    ......|.|...|:.|..::||..     :.::..|
  Fly   127 RLPETQQRSLLQEPFEYSEEPRGDDDEWNQLLKYGLRRAERFIKSTALEVEWP-----EELTEAG 186

  Fly   138 RALEDASESLFGSND-----------PNAPEESRGKKKKAAKILGPILALVALKAAALLPLLLGA 191
            |     .|:.|..||           ..|...||.|.||....|..:|.:..||....||.:|| 
  Fly   187 R-----YEARFIGNDIDGELDLIDDGQRAGHFSRKKLKKMIIPLLLVLKIFKLKLLLFLPFILG- 245

  Fly   192 IALIAGKALLIGKIALV------------------------LSAVIGLKKLLSQEKHVTYEVVAH 232
               |||...::|..|:|                        ||.:.|.|....:..........:
  Fly   246 ---IAGLKKILGLAAIVLPGLFAYFKLCRPPGGVGGAFGGGLSGLFGGKNTFPEYNPQGVGAATY 307

  Fly   233 PHHSSSHSTSH-------------------DSYGSGYSA------DAGASSASYGSSGHGGWGRS 272
            .||.......|                   |.|...|..      ..|.:|.|:|          
  Fly   308 YHHHEHFEGGHGGAPGPYYRQEPSFAKPYTDYYSKSYQGQQVQGQQVGGNSVSFG---------- 362

  Fly   273 IDAQDLAY 280
             |.|:.||
  Fly   363 -DPQEAAY 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi7NP_649626.1 DUF1676 46..217 CDD:400313 52/216 (24%)
Osi2NP_001262303.1 DUF1676 108..224 CDD:285181 30/126 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.