DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi5 and Osi20

DIOPT Version :9

Sequence 1:NP_649624.1 Gene:Osi5 / 40759 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_649641.1 Gene:Osi20 / 40777 FlyBaseID:FBgn0037430 Length:280 Species:Drosophila melanogaster


Alignment Length:272 Identity:60/272 - (22%)
Similarity:100/272 - (36%) Gaps:101/272 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FRTFPLL---CLLFLTAVRSENCDQDAGATLYCRGERALRNVLRNLNRSDKPLV----------- 52
            ||:..||   |.|.|.|..|.     :||        |:.|.:.....|...|:           
  Fly     3 FRSTSLLAFGCALLLVASTSV-----SGA--------AIENAVTPRIHSSDELISTIVDKCFHAN 54

  Fly    53 --------VIRGLEIV-----PLQNNSISDEEPDQEQGLLDSLSFYLRTHEINVKL--------- 95
                    |:..|:.|     .:...::.|:..|:.  ::|.|...|.|:|:.::|         
  Fly    55 AMHCLKEKVLTYLDTVANVEEEVSGRALGDDVIDKV--IVDRLGRILNTNEMRLQLPQTFFAGSV 117

  Fly    96 ----------ADLLEDESQVSEARKKDKGQGMLLAMALMFGKMMAVMG--LGGIAALAMKALGVS 148
                      .:|.:||.:   |.||:|.:..|..:.||..|:..:|.  |..|...|.|||.:|
  Fly   118 VTYRSDRGFDLELPKDEGR---AEKKNKDKLFLPLLLLMKFKLKVIMPILLALIGLKATKALILS 179

  Fly   149 LVAL-MMAGML---------GLK----------TAAQHGGESSHSISYVTGEGHHHKRRRRSSGQ 193
            .:|: ::.|.|         |:|          .|:::|..|:.:.||            ..|..
  Fly   180 KIAIKLVLGFLIYNLIQKLGGMKMNMVPMPAPVPASEYGVPSTTASSY------------DPSSW 232

  Fly   194 QPLA---YRGWD 202
            :|::   |..||
  Fly   233 EPMSGGPYARWD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 18/89 (20%)
RCR 184..>201 CDD:304939 3/19 (16%)
Osi20NP_649641.1 DUF1676 <73..141 CDD:285181 13/72 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.