DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Osi5 and Osi17

DIOPT Version :9

Sequence 1:	NP_649624.1	Gene:	Osi5 / 40759	FlyBaseID:	FBgn0037413	Length:	202	Species:	Drosophila melanogaster
Sequence 2:	NP_001262307.1	Gene:	Osi17 / 40774	FlyBaseID:	FBgn0037427	Length:	750	Species:	Drosophila melanogaster

Alignment Length:	46	Identity:	13/46 - (28%)
Similarity:	19/46 - (41%)	Gaps:	20/46 - (43%)

- Green bases have known domain annotations that are detailed below.

  Fly   158 LGLKTAAQHGGESSHSIS--------------------YVTGEGHH 183
            |.::.:||....||||::                    ||.|:|||
  Fly   518 LQMQLSAQKVQASSHSLNPFQSQDKQSSRPAHTQHHPVYVPGQGHH 563

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Osi5	NP_649624.1	DUF1676	<55..121	CDD:285181
Osi5	NP_649624.1	RCR	184..>201	CDD:304939	13/46 (28%)
Osi17	NP_001262307.1	DUF1676	180..270	CDD:285181
		Prefoldin	603..>680	CDD:298833
		DM4_12	661..745	CDD:299813
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR21879
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100