powered by:
Protein Alignment Osi5 and Osi17
DIOPT Version :9
Sequence 1: | NP_649624.1 |
Gene: | Osi5 / 40759 |
FlyBaseID: | FBgn0037413 |
Length: | 202 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001262307.1 |
Gene: | Osi17 / 40774 |
FlyBaseID: | FBgn0037427 |
Length: | 750 |
Species: | Drosophila melanogaster |
Alignment Length: | 46 |
Identity: | 13/46 - (28%) |
Similarity: | 19/46 - (41%) |
Gaps: | 20/46 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 158 LGLKTAAQHGGESSHSIS--------------------YVTGEGHH 183
|.::.:||....||||:: ||.|:|||
Fly 518 LQMQLSAQKVQASSHSLNPFQSQDKQSSRPAHTQHHPVYVPGQGHH 563
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR21879 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.