powered by:
Protein Alignment Osi5 and Osi17
DIOPT Version :10
| Sequence 1: | NP_649624.1 |
Gene: | Osi5 / 40759 |
FlyBaseID: | FBgn0037413 |
Length: | 202 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001262307.1 |
Gene: | Osi17 / 40774 |
FlyBaseID: | FBgn0037427 |
Length: | 750 |
Species: | Drosophila melanogaster |
| Alignment Length: | 46 |
Identity: | 13/46 - (28%) |
| Similarity: | 19/46 - (41%) |
Gaps: | 20/46 - (43%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 158 LGLKTAAQHGGESSHSIS--------------------YVTGEGHH 183
|.::.:||....||||:: ||.|:|||
Fly 518 LQMQLSAQKVQASSHSLNPFQSQDKQSSRPAHTQHHPVYVPGQGHH 563
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| Osi5 | NP_649624.1 |
DUF1676 |
<61..161 |
CDD:462310 |
1/2 (50%) |
| Osi17 | NP_001262307.1 |
DUF1676 |
162..>271 |
CDD:462310 |
|
|
Blue background indicates that the domain is not in
the aligned region.
|
Return to query results.
Submit another query.
