DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi5 and Osi15

DIOPT Version :9

Sequence 1:NP_649624.1 Gene:Osi5 / 40759 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_649636.1 Gene:Osi15 / 40771 FlyBaseID:FBgn0037424 Length:214 Species:Drosophila melanogaster


Alignment Length:218 Identity:55/218 - (25%)
Similarity:92/218 - (42%) Gaps:40/218 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LCLLFLTAVRSENCDQDAGATLYCRGERAL-------RNVLRNLNR--SDKPLVVIRGLEIVPLQ 63
            :|..|:..|..        |:|.| |..||       |:::..|||  |::.:.:..||.| ...
  Fly     1 MCAKFVCVVLL--------ASLVC-GSMALPSQDNTERDLVNMLNRLDSEESVALFGGLRI-DRS 55

  Fly    64 NNSISDEEPDQEQGLLDSLSFYLRTHEINVKLADLLEDESQVSE--ARKKDKGQG---------M 117
            .:..|.......:...|....||.|||:|:..:...:||:..:|  .|..|:.:.         :
  Fly    56 ESGRSFGASKAVESFEDRAERYLETHELNLSFSGDEQDENSENEYTGRAMDESRSKRMKKMLLPL 120

  Fly   118 LLAMALMFGKMMAVMGLGGIAALAMKALGVSLVALMMAGMLGLKTAAQHGGESSH-SISYVTGEG 181
            |||:.|....::.:| ...|..:::|||.:|.:||::||....|...  ..:..| :.:|:||..
  Fly   121 LLALKLKKAVVVKIM-FTIIKFISLKALAISFLALILAGATFFKDLL--AKKKEHITTAYITGSP 182

  Fly   182 ------HHHKRRRRSSGQQPLAY 198
                  |....|...:|...|||
  Fly   183 LNADIVHSDWSRNGQAGAADLAY 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 18/76 (24%)
RCR 184..>201 CDD:304939 5/15 (33%)
Osi15NP_649636.1 DUF1676 31..163 CDD:311725 34/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.