DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi5 and Osi13

DIOPT Version :9

Sequence 1:NP_649624.1 Gene:Osi5 / 40759 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_649634.1 Gene:Osi13 / 40769 FlyBaseID:FBgn0037422 Length:210 Species:Drosophila melanogaster


Alignment Length:170 Identity:37/170 - (21%)
Similarity:68/170 - (40%) Gaps:47/170 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PLVVIRGLEIVPLQNNSISDEEPDQEQG----------------LLDSLSFYLRTHEINVKLADL 98
            |:|.:.|..:..::.::..:...::.|.                :.|.||    |.|:|    ::
  Fly    27 PVVQMGGAIVAAVEQDAEQEAAAEERQRVERHWLSMAETQLHSLITDDLS----TEEVN----NM 83

  Fly    99 LEDESQVSEARKKDKGQGMLLAM------ALMFGKMMAV-MGLGGIAALAMKALGVSLVALMMAG 156
            ||..|  :|.|.|.|.|..|:.|      |:...|::.: :.|..:.||:..:..:..:||:.:|
  Fly    84 LETWS--TEGRGKHKKQKKLMKMVYPLLAAVAVAKVVLLPLILKWLTALSTSSFVMGKIALVTSG 146

  Fly   157 MLGLKTAAQHGGESSHSISYVTGEGHHHKRRRRSSGQQPL 196
            :|.||              ::...||.|.|........||
  Fly   147 ILALK--------------WILSGGHAHDRLEIIHSHAPL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 17/81 (21%)
RCR 184..>201 CDD:304939 4/13 (31%)
Osi13NP_649634.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453103
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.