DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi5 and Osi11

DIOPT Version :9

Sequence 1:NP_649624.1 Gene:Osi5 / 40759 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_649630.1 Gene:Osi11 / 40765 FlyBaseID:FBgn0037418 Length:302 Species:Drosophila melanogaster


Alignment Length:233 Identity:60/233 - (25%)
Similarity:89/233 - (38%) Gaps:70/233 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LTAVRSENCDQDAGATLYCRGERALRNVLRNLNRSDKPLVVIRGLEIVPLQNNSISDEEPDQEQG 77
            ::.||.|:..||.         |:.|:.|.....|::.|..:.|..:..|               
  Fly    80 VSLVRRESFTQDT---------RSGRSSLLESQLSNRDLEHLSGKSLDAL--------------- 120

  Fly    78 LLDSLSFYLRTHEINVKLADLLE-DESQV----------------SEARKK---DKGQGMLLAMA 122
            ||:....::.:|::.|.|..||. .|..|                ||.|||   .|..|..:| |
  Fly   121 LLERFLNFVHSHQLQVNLPRLLRFGERNVQDWLLHVVGYFMPASESEGRKKKDDKKYLGPFIA-A 184

  Fly   123 LMFGKMMAVMGLGGIAALAMKALGVSLVALMMAGMLGLKTAAQH-GGE----------------- 169
            ::....:..|....||.:|.|||.|..:||:::.::|||....| |||                 
  Fly   185 VLLKTAILKMAYHSIAIVAGKALIVGKIALIISAIIGLKKLVGHDGGEKTTYEIVKHPQVQQSHT 249

  Fly   170 --SSHSISYVTGEGH----HHKRRRRSSGQQPLAYRGW 201
              |||...|.|| ||    :|:........|..||:.|
  Fly   250 YSSSHQGEYDTG-GHDGGSYHRSIDDEMMMQDKAYQAW 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 18/85 (21%)
RCR 184..>201 CDD:304939 4/16 (25%)
Osi11NP_649630.1 DUF1676 65..180 CDD:285181 27/123 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.