DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi5 and Osi8

DIOPT Version :9

Sequence 1:NP_649624.1 Gene:Osi5 / 40759 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_649627.1 Gene:Osi8 / 40762 FlyBaseID:FBgn0037415 Length:274 Species:Drosophila melanogaster


Alignment Length:228 Identity:61/228 - (26%)
Similarity:99/228 - (43%) Gaps:55/228 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ENCDQDAGAT-----------LY--CRGER-------ALRNVLRNLNRSDKPLVVIRGLEIV--- 60
            :|.:...|:|           :|  |.|:.       .|...|....||.|.|.::.|::.|   
  Fly    43 QNSNPGMGSTGLWKDMSMVYRIYQQCSGDNMSVCLKVKLLTGLEKAFRSAKSLSLMEGIQFVSSG 107

  Fly    61 ---------PLQNNSISDEEP---DQEQGLLDSLSF-----YLRTHEINVKLADLLEDESQVSEA 108
                     |:....|....|   |.::.:|:::..     :|:.|.:.||    .::|:...|.
  Fly   108 GESEETKRAPISEKDIEAVLPRSVDAKEQVLNNMILKRVGNFLQDHTLQVK----FDNEANSVEG 168

  Fly   109 RKK--DKGQGMLLAMALMFGKMMAVMGLGGIAALAMKALGVSLVALMMAGMLGLKTAAQHGG--- 168
            |||  .||.|.::.:.|:.|..:..:..|.:|.||.|||.||.:||::|.::|:|.....||   
  Fly   169 RKKKEKKGNGAMIMIPLLLGGTIVPLAYGALAMLAGKALIVSKLALVLASIIGIKKLLSGGGGGK 233

  Fly   169 ESSHSISYVTGEGHHHKRRRRSSGQQPLAYRGW 201
            ||||.: .|:..||....|...:     ||.||
  Fly   234 ESSHEV-VVSSGGHSGWGRELDT-----AYSGW 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 19/87 (22%)
RCR 184..>201 CDD:304939 3/16 (19%)
Osi8NP_649627.1 DUF1676 85..>169 CDD:285181 18/87 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453099
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.