DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi5 and Osi7

DIOPT Version :9

Sequence 1:NP_649624.1 Gene:Osi5 / 40759 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_649626.1 Gene:Osi7 / 40761 FlyBaseID:FBgn0037414 Length:288 Species:Drosophila melanogaster


Alignment Length:265 Identity:66/265 - (24%)
Similarity:107/265 - (40%) Gaps:69/265 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TFPLLCLLFLTAV--------RSENC---DQDAGATLY----------CRGERALRNVLRNLNRS 47
            ||.:|||:.|:|.        .:.|.   :.|...::|          |...:....|.:.|...
  Fly     7 TFGVLCLVALSAALPAEETRGHARNAIGGENDIMDSIYSDCLRKDSVSCVKYKLFSFVDKVLGAR 71

  Fly    48 DKPLVVIRGLEIV-----PLQN--NSISDEEPDQEQGLLDSLSFYLRTHEINVKL--ADL----- 98
            |: ..:..|:.:|     |.|.  .|||.:| ..|...|:.:|.:|.:|.|.|:|  ||:     
  Fly    72 DQ-FALTEGVTVVRSPDAPQQEAARSISGDE-SFESLALNRISSFLNSHTIKVELKGADIVQAVS 134

  Fly    99 -----LEDES------------QVSEARKKDKGQ--GMLLAMALMFGKMMAVMGLGGIAALAMKA 144
                 |||.|            :.|..:||...:  |.:||:..:....:..:.||.||.:|.||
  Fly   135 STGRALEDASESLFGSNDPNAPEESRGKKKKAAKILGPILALVALKAAALLPLLLGAIALIAGKA 199

  Fly   145 LGVSLVALMMAGMLGLK------------TAAQHGGESSHSISYVT-GEGHHHKRRRRSSGQQPL 196
            |.:..:||:::.::|||            ..|.....||||.|:.: |.|:.......|:.....
  Fly   200 LLIGKIALVLSAVIGLKKLLSQEKHVTYEVVAHPHHSSSHSTSHDSYGSGYSADAGASSASYGSS 264

  Fly   197 AYRGW 201
            .:.||
  Fly   265 GHGGW 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 27/98 (28%)
RCR 184..>201 CDD:304939 1/16 (6%)
Osi7NP_649626.1 DUF1676 46..217 CDD:400313 44/172 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453102
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.