DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi5 and Osi4

DIOPT Version :9

Sequence 1:NP_649624.1 Gene:Osi5 / 40759 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001262305.1 Gene:Osi4 / 40758 FlyBaseID:FBgn0037412 Length:395 Species:Drosophila melanogaster


Alignment Length:150 Identity:36/150 - (24%)
Similarity:52/150 - (34%) Gaps:64/150 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KDKGQ-----GMLLAMALMFG-KMMAVMGLGGIAALAMKALGVSLVALMMAGMLGLK----TAAQ 165
            :||.|     .|.|| |..|| .|:|...:|   .|.:|||.:|.:|.::|.::.:|    .|::
  Fly   208 QDKKQFQMFIPMYLA-ATTFGWTMVAAKAVG---LLTLKALILSKIAFVVAAIVLIKKLMDNASE 268

  Fly   166 ----------------------HGGE--------SSHSISYVTG-----------------EGHH 183
                                  ||.|        |.|.::...|                 |.|.
  Fly   269 KMMYQFPEQTPYMMPYGMDYPLHGAEISPEMYPSSLHHLAMAGGGQLPGHPGHPGLESLSAESHL 333

  Fly   184 HKRRRRSSGQ---QPLAYRG 200
            |..:..|.|.   |.||..|
  Fly   334 HSAQVSSDGSNNTQVLAALG 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 5/14 (36%)
RCR 184..>201 CDD:304939 6/19 (32%)
Osi4NP_001262305.1 DUF1676 <210..261 CDD:311725 18/54 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.