DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi5 and Osi3

DIOPT Version :9

Sequence 1:NP_649624.1 Gene:Osi5 / 40759 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001262304.1 Gene:Osi3 / 40757 FlyBaseID:FBgn0037411 Length:288 Species:Drosophila melanogaster


Alignment Length:253 Identity:56/253 - (22%)
Similarity:98/253 - (38%) Gaps:80/253 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FLTAVRSENCDQDAGATLYCRGERALR----NVLRN-------LNRSDKPLVVIRG-LEIVP--- 61
            ||.|...:||.|:        .:||.:    :::.|       ::..|:..|...| :.:||   
  Fly    42 FLLAKLKQNCRQE--------DDRACKMVKMSIVMNHLYLNTRIDLGDRFKVTENGNISMVPDDP 98

  Fly    62 ----LQNNSISDEEPDQEQGLLDSLSFYLRTHEINVKLAD----LLEDESQ-------------- 104
                |.:.|:..:|......:.:.|..::|:..:..|.::    ::..:.:              
  Fly    99 EVNQLLSRSMGSDEETFALLMANKLWKFIRSRSLRYKFSENTDFVINSDPEGSLNLGVSVRPLEA 163

  Fly   105 VSEARKKDKGQGMLLAMALMFGKMMAVMGLGGIAALAMKALGVSLVALMMAGMLGL-------KT 162
            :.|.|.|.|..|.||.|......|:..:.|.|:..||.|||.||.:||::|.::.|       ||
  Fly   164 LQEGRGKMKNMGPLLMMMAAKTGMVGALLLKGLFLLAGKALIVSKIALLLAVIISLKKLLSSKKT 228

  Fly   163 AAQHGGESSHSISYVTG----------------------EGHHHKRRRRS---SGQQP 195
            ..:   ..||..||.:|                      |..|.:.:.::   |||||
  Fly   229 IVE---VPSHHDSYSSGWSRAFDGFVEGLVDVPADILAKEVQHQQEQAQNMAYSGQQP 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 16/91 (18%)
RCR 184..>201 CDD:304939 5/15 (33%)
Osi3NP_001262304.1 DUF1676 68..180 CDD:285181 19/111 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.