DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi4 and Osi23

DIOPT Version :9

Sequence 1:NP_001262305.1 Gene:Osi4 / 40758 FlyBaseID:FBgn0037412 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_651794.2 Gene:Osi23 / 43615 FlyBaseID:FBgn0039771 Length:255 Species:Drosophila melanogaster


Alignment Length:234 Identity:51/234 - (21%)
Similarity:85/234 - (36%) Gaps:84/234 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 WKCANNASCLYGVANGLMASYRRGETLKLGLFDLVKLPELDASRKHKWGTGRGLSGFMDFVTENA 123
            |.|..:.|  ..:..|:|:|      .::.::|.|:|.....|                  |:||
  Fly    55 WSCFRSRS--LHIFEGIMSS------PEISIYDGVRLVAAPNS------------------TDNA 93

  Fly   124 IRVPVGPMVFSVQRAEDDS----------DYIEVALLKKTSSSTGRLQVNGGGL----LGGGGGL 174
            .|             .||.          |.:.|:|.|..::.|  ||||.|.|    |      
  Fly    94 TR-------------PDDERKDLKHLTWFDQLAVSLAKGLTTHT--LQVNLGKLTERYL------ 137

  Fly   175 GGNGGGGGGLLGGGGGDNGGGGGLLGGR-RRHQHQDKKQFQMFIPMYLAATTFGWTMV--AAKAV 236
                          ..|......:...| |||      ::.|.|.|....|..|..:|  ..:.:
  Fly   138 --------------SSDTSNPDPVGSARVRRH------RYNMIITMMFGVTALGAILVPMGFQML 182

  Fly   237 GLLTLKALILSKIAFVVAAIVLIKKLMDNASEKMMYQFP 275
            .:::.|||:|:|:|.::|:|..:|::.:|.....:|..|
  Fly   183 SIVSGKALLLAKMALLLASINGLKRVANNGLHYGLYHVP 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi4NP_001262305.1 DUF1676 <210..261 CDD:311725 14/52 (27%)
Osi23NP_651794.2 DUF1676 66..163 CDD:285181 32/161 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.